(data stored in ACNUC7421 zone)

EMBL: CP000489.PE383

CP000489.PE383       Location/Qualifiers
FT   CDS_pept        359492..360115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0386"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   sit:TM1040_1580 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68500"
FT                   /db_xref="GOA:A1AZ06"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ06"
FT                   /protein_id="ABL68500.1"
FT                   /translation="MCGRFVDPNLRGTSFEISQTRLHPFPRRYNIKPTQDVLVITTDAP
FT                   EGEMARWWLVPSWHKGDLRDWKATTFNARIEDAASKPTFRGPWRYGRCLIPAGGYYEWT
FT                   GEKGHKQPHFISSAGNDDTLWFAGLVSRWNDMLTCTIVTRPANASVADIHTRMPVILNA
FT                   DERDAWLAGSDDPEIGAGAQLRHHPVARFGTASDGPELIDPTAA"
     atgtgcggac gatttgttga cccgaacttg cgcgggacct ctttcgagat atcgcagacc        60
     aggctgcatc cgttcccgcg gcgctacaac atcaagccca cgcaggatgt gttggtgatc       120
     accacagacg ccccagaggg agagatggcg cgctggtggc tggtgccatc ctggcacaag       180
     ggcgatctgc gggactggaa agccacgacg ttcaacgccc ggatcgagga cgcggccagc       240
     aagccgactt ttcgcggccc gtggcgctat gggcgctgcc tgatcccggc cgggggctat       300
     tacgagtgga ccggcgagaa ggggcacaaa cagccgcatt tcatcagcag cgcgggcaac       360
     gacgatacct tatggtttgc cggactcgtc tcgcgctgga acgatatgct cacctgcacc       420
     atcgtcaccc ggcccgccaa cgcctcggtt gctgacatcc acacgcgcat gccggtgatc       480
     ctgaacgcgg acgaacggga cgcctggctt gccggcagcg atgatcccga gattggcgcc       540
     ggcgcgcaac tgcgccacca ccctgtagcg cgattcggca cggccagcga tggcccggaa       600
     ctgatcgacc ccaccgcagc gtga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page