(data stored in ACNUC7421 zone)

EMBL: CP000489.PE384

CP000489.PE384       Location/Qualifiers
FT   CDS_pept        360185..360424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68501"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ07"
FT                   /protein_id="ABL68501.1"
FT                   /translation="MMIIGNVLAVEPEDSMEAHVRRYLAFRFAGHAIVDLRGQDEIWTA
FT                   RLHSAEAGDAVVTIKADLIEDDLYLAFDILDMAA"
     atgatgatca tcggtaacgt tctggcggtc gagccagagg acagcatgga ggcgcatgtg        60
     cgccgctatc tcgcattccg gtttgccggg catgccatcg tggacctgcg cggccaagat       120
     gaaatctgga cggcgcggtt gcactcggcc gaggccggag acgccgtggt cacgatcaag       180
     gccgatctga tcgaggatga tctgtatctg gcctttgaca tcctcgacat ggcggcgtga       240
//

If you have problems or comments...

PBIL Back to PBIL home page