(data stored in ACNUC7421 zone)

EMBL: CP000489.PE385

CP000489.PE385       Location/Qualifiers
FT   CDS_pept        360445..360705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68502"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ08"
FT                   /protein_id="ABL68502.1"
FT                   /translation="MKLRVIRDWNRRWRFRPVRDTGGYVIENTYDLLRNGVVVGRVQRE
FT                   WGGEWSWDIYTEPKERGWAGTMTEALHDARNALGLRHIAAP"
     atgaagttgc gggtcatccg tgattggaac cgtcgttggc ggttccgacc cgtccgggac        60
     accggcggtt acgtgatcga gaacacatac gatctcctgc gcaacggtgt cgtcgtcggt       120
     cgggtgcagc gcgaatgggg cggcgagtgg tcttgggaca tctataccga gcccaaggag       180
     cggggctggg ccggcactat gaccgaggcg ctgcacgatg ccaggaacgc gcttgggctg       240
     cggcatatcg cggcgcccta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page