(data stored in ACNUC7421 zone)

EMBL: CP000489.PE388

CP000489.PE388       Location/Qualifiers
FT   CDS_pept        complement(362346..362717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68505"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ11"
FT                   /protein_id="ABL68505.1"
FT                   /translation="MTDPQAPETANPSHAARLWLALLLALLVVMLPGPQVTATASQSKQ
FT                   LTTPTLALTAIHGRDLIARKDAVQIRPLTATALPPPEPLPPPPRAAASVAYAHQPQIGV
FT                   CACTLAPCARAPPSFRMTA"
     atgacggacc cacaggctcc tgagacagca aacccatcgc atgcggcaag gctatggctg        60
     gccctgctgc tggccctgct ggtcgtcatg ttgccgggac cacaggtcac cgcgacggcc       120
     agccagtcca agcaactgac cacgccgacg ctggccctga cggcgatcca tgggcgcgac       180
     ctgatcgccc gcaaggatgc ggtgcagatc cgcccactga ccgcgactgc gctgccgccg       240
     ccggagcccc tgccgccgcc gccgcgcgcc gccgcatcgg ttgcctacgc ccatcaaccg       300
     caaatcgggg tctgcgcctg cacgctcgcc ccctgtgccc gtgcaccacc gtcctttcgc       360
     atgaccgcct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page