(data stored in ACNUC7421 zone)

EMBL: CP000489.PE390

CP000489.PE390       Location/Qualifiers
FT   CDS_pept        363233..363715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bms:BR0799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68507"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ13"
FT                   /protein_id="ABL68507.1"
FT                   /translation="MTGKHCSPVIACPALLDFLAYARSLEGRWIMQNKAILIVGPLLFA
FT                   ACTASDNYSEIIARSTPPGAALKAEIVAGAKELIYDPASIRDAEISNVATLPDGLQGVC
FT                   VRADSKDVSGRYLGLHSIGIPIRDGKIAGGSLDHPLCDRADIQWQPFPELERLPGA"
     atgacaggaa agcactgcag tccggttatc gcttgtcccg cgctcttgga cttcctagcc        60
     tatgcccggt ctctggaggg aaggtggatc atgcagaaca aagccattct gattgtcggg       120
     ccgttgctgt tcgcggcctg caccgcatcg gacaactaca gcgaaatcat tgcgcgctcc       180
     acgccgcctg gcgccgcctt gaaggccgag atcgtcgctg gcgccaaaga actcatctat       240
     gaccccgcct cgatccgcga tgccgagatt tccaatgtgg cgaccctgcc ggatgggctg       300
     caaggcgttt gcgtccgcgc cgacagcaag gatgtctccg gccgctacct cgggctgcac       360
     agcataggca tcccgatccg tgacgggaag attgccggcg gcagcctgga tcaccccctc       420
     tgtgaccgcg cggacattca gtggcagccc tttcccgagc ttgagcggct tcccggcgcc       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page