(data stored in ACNUC7421 zone)

EMBL: CP000489.PE391

CP000489.PE391       Location/Qualifiers
FT   CDS_pept        364225..364824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_A0063 succinoglycan biosynthesis
FT                   protein ExoI"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68508"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ14"
FT                   /protein_id="ABL68508.1"
FT                   /translation="MRPSWMPPAARCAARAKPAATVASAGTNYAAKASAVPAIVDRRAT
FT                   PSAAILTAVRSDYRDFDAPIGTGIATIATIAGIAAVRALVVGAVLVMPAVTWAATDGSP
FT                   LIACRAVVVDGDLLIWQSESQLAWEYRADRWARAATEAPEGCPIKGNISKKGERIYHAP
FT                   WSPAYAETRIDESKGERWFCDEAEAIAASWRAARWR"
     atgcggccct cctggatgcc tcctgctgca agatgtgcag caagggcaaa gcctgcggcg        60
     acagttgcat cagccgggac aaactatgcc gcaaaggcgt cggctgtgcc tgcgatagtt       120
     gatcggcggg ccacgccctc cgccgcaatc ctgacggcag tgcgtagcga ttatcgcgat       180
     tttgatgccc ctatcgggac tggaatcgcg acaatcgcga caatcgcggg aatcgcagcg       240
     gttagggctt tggtcgttgg cgcggtgctg gtgatgcccg ccgtcacctg ggccgcgact       300
     gacggtagcc ctttgattgc ctgccgtgcc gtggtggtgg acggcgactt actcatctgg       360
     cagagcgaat ctcagcttgc ctgggagtat cgcgccgacc gctgggcgcg ggctgccaca       420
     gaggcgcccg agggctgtcc gatcaagggc aacatctcga agaagggcga gcggatctat       480
     cacgcgccct ggtcgccggc ctatgccgag acccggatcg atgagagcaa gggcgagcgc       540
     tggttttgcg acgaggccga ggctatcgcc gccagttggc gcgcggcgcg ctggcgctag       600
//

If you have problems or comments...

PBIL Back to PBIL home page