(data stored in ACNUC7421 zone)

EMBL: CP000489.PE393

CP000489.PE393       Location/Qualifiers
FT   CDS_pept        365939..367201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0396"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: rsp:RSP_0935 MiaB-like radical SAM protein;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; MiaB-like
FT                   tRNA modifying enzyme; PFAM: Radical SAM domain protein;
FT                   Protein of unknown function UPF0004-like; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68510"
FT                   /db_xref="GOA:A1AZ16"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ16"
FT                   /protein_id="ABL68510.1"
FT                   /translation="MKDLKPPVFATLGCRLNAYETEAMREMAEAAGLQGAVIVNTCAVT
FT                   AEAVRKARQEIRRLARENPGAPVIVTGCAAQTEPETFAAMAEVSRVIGNHEKMQPATWA
FT                   AMQAPDLIGETEKVQVDDIMSVKETAGHLIDGFGRHRAYVQVQNGCDHRCTFCIIPYGR
FT                   GNSRSVPAGVVVDQIKRLRDRGFNEVVLTGVDLTSWGADLPGQPRLGDLVMRILRLVPD
FT                   LPRLRISSIDSIEADENLMLAIATEPRLMPHLHLSLQAGDDMILKRMKRRHLRDDAIRF
FT                   CEEARRLRPGIAFGADIIAGFPTETEAMFENSLKLVEDCGLTFLHVFPYSARKGTPAAR
FT                   MPRVPGPAIKERAARLRAAGDAALARHLQAQLGEARMVLTEGPRLGRTEHFTEVAFDRD
FT                   MPEGTLMALRIAGHDGQRLTV"
     atgaaggatc tgaagccccc ggttttcgcg accctcggct gtcggctgaa cgcctatgag        60
     accgaggcca tgcgcgagat ggccgaggcc gccgggctgc aaggcgcggt gatcgtgaac       120
     acctgcgcgg tgacggccga ggcggtgcgc aaggcccggc aggagatccg ccggctggcg       180
     cgcgagaatc cgggcgcccc ggtcatcgtc accggctgcg cggcgcaaac cgagcccgag       240
     acattcgccg ccatggccga ggtcagccgc gtgatcggca accacgagaa gatgcagccc       300
     gcgacctggg ccgcgatgca ggcccccgac ctgatcggcg agaccgagaa ggtgcaggtc       360
     gacgacatca tgtcggtcaa ggaaaccgcc gggcacctga tcgacggttt cggccggcat       420
     cgcgcctatg tgcaggtgca gaacggttgc gatcatcgct gcaccttctg catcatcccc       480
     tacggccgcg gcaattcgcg ctcggtgccg gcgggggtcg tggtcgatca gatcaagcgg       540
     ctgcgggacc gcggcttcaa cgaggtggtg ctgaccgggg tggacctgac ctcctggggg       600
     gccgacctgc cggggcagcc gcggttgggc gacctggtca tgcgcatcct gcggctggtg       660
     ccggacctgc cgcggctgcg gatcagctcg atcgattcga tcgaggccga cgagaacctg       720
     atgctggcca tcgccaccga gccccggctg atgccgcatc tgcacctgtc cctgcaggcg       780
     ggcgacgaca tgatcctgaa gcggatgaag cgccgccacc tgcgcgacga cgccatccgg       840
     ttctgcgaag aggcgcggcg gctgcgtccc ggcatcgcct tcggcgccga catcatcgcc       900
     ggcttcccga ccgagaccga ggcgatgttc gagaacagcc tgaagctggt cgaggattgc       960
     gggctgacct tcctgcatgt gtttccctat tcggcgcgga agggcacccc ggcggcgcgg      1020
     atgccgcgcg tgcccggccc ggcgatcaag gagcgcgcgg cccggctgcg ggcggcgggc      1080
     gatgcggcgc tggcccggca tttgcaggcc cagctcggcg aggcgcgcat ggtgttgacc      1140
     gaggggccgc gcctgggccg gacggagcat ttcaccgagg tcgccttcga ccgcgacatg      1200
     cccgagggca cgctgatggc gttgcgcatc gcgggccatg acggacagcg gctgacggtc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page