(data stored in ACNUC7421 zone)

EMBL: CP000489.PE395

CP000489.PE395       Location/Qualifiers
FT   CDS_pept        368315..368557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0398"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII, small subunit; KEGG: jan:Jann_0090
FT                   exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68512"
FT                   /db_xref="GOA:A1AZ18"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ18"
FT                   /protein_id="ABL68512.1"
FT                   /translation="MTGTEIENMSFEEAMKELEATVGRLEHGEATLEESIKLYERGAAL
FT                   RAHCDKRLREAEERVEKITLAANGQPTGTVPAEGL"
     gtgaccggga ccgagatcga gaacatgtcc ttcgaggagg cgatgaaaga gcttgaggcg        60
     accgtcggtc gtctggagca tggcgaggcc acgctggagg aatcgatcaa gctttacgaa       120
     cgcggcgcgg cgttgcgggc gcattgcgac aagcgcctgc gcgaggccga ggagcgggtc       180
     gaaaagatca cgctggcggc caatggccaa cccacgggca ccgtgccggc cgaggggctg       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page