(data stored in ACNUC7421 zone)

EMBL: CP000489.PE397

CP000489.PE397       Location/Qualifiers
FT   CDS_pept        369446..371368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0400"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein; KEGG: sil:SPO0247 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68514"
FT                   /db_xref="GOA:A1AZ20"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ20"
FT                   /protein_id="ABL68514.1"
FT                   /translation="MTHETSDRPSTPILDRVHLPSDLKDLTDRELRQLADELRAETVSA
FT                   VSVTGGHLGAGLGVVELTVALHAVFDAPRDKIIWDVGHQCYPHKILTGRRDRIRTLRME
FT                   GGLSGFTKRSESPYDPFGAGHSSTSISAALGFAMARELGGDPGDAIAVIGDGAMSAGMA
FT                   FEALNNAGDLGKRLFVVLNDNEMSIAPPTGALSRYLTRLYAEGPFQDLKAVAKGAVGFL
FT                   PPTLQEGARRAKEMLKGMTVGGTLFEELGFSYIGPVDGHDLDQLLPLLRTVKARATGPV
FT                   LLHVVTRKGKGYGPAERAADKGHATAKFDVETGAQAKAKSNAPSYTSVFARALVDQASR
FT                   DARIVAVTAAMPDGTGLNLMAERFPRRCFDVGIAEQHAVTFSAGLAAGGMKPFCALYST
FT                   FLQRGYDQVVHDVAIQRLPVRFAIDRAGLVGADGATHAGAYDVAFLANLPGMVVMAAAD
FT                   EAELVHMVATAAAHDEGPIAFRYPRGEGTGVEMPERGEVLVIGKGRVMAEGKGVAILSF
FT                   GTRLSEVMRARESLAARGVSPTVVDARFAKPLDRDLILRLARTHEALITIEEGAVGGFG
FT                   SLVAQLLADEGVFDGGLRFRQMVLPDTFIDHASPEAMYREARMSAPDIEAKVLEVLGVA
FT                   LAKRA"
     atgacccatg agacttccga ccgcccttcg acgccgatcc tggaccgggt gcatctgcca        60
     tccgacctca aggatctgac cgatcgcgag ctgcgccagc ttgccgacga gttgcgggcc       120
     gagacggtca gcgccgtttc cgtgaccggc ggccatctgg gtgccgggct gggggtggtc       180
     gagctgaccg tggcgctgca tgcggtcttt gacgcgccgc gcgacaagat catctgggac       240
     gtgggccatc agtgctatcc gcacaagatc ctgaccgggc ggcgcgaccg catccgcacc       300
     ctgcggatgg agggcgggct ttccggcttc accaagcggt cggaaagccc ctatgacccg       360
     ttcggcgccg ggcacagctc gacctcgatc agcgcggcgc tgggctttgc catggcgcgc       420
     gaactgggtg gcgatccggg cgatgccatc gcggtgatcg gcgacggcgc gatgagcgcg       480
     ggcatggcct tcgaggcgct gaacaatgcg ggcgacctgg gcaagcggct gttcgtggtg       540
     ctgaacgaca acgagatgtc catcgcgccg cccaccgggg cgctgtcgcg ctatctgacc       600
     cggctttacg ccgagggccc gttccaggat ctgaaggccg tggccaaggg cgccgtcggc       660
     ttcctgccgc ctacgctgca agagggcgcg cgccgcgcca aggagatgct caagggcatg       720
     accgtcggcg gcaccctgtt cgaggaactg gggttctcct atatcggccc ggtcgacggc       780
     cacgacctcg accagcttct gccgcttttg cgcacggtca aggcacgggc gacggggccg       840
     gttctgctgc atgtcgtgac ccgcaagggc aagggctacg gcccggccga gcgcgccgcc       900
     gacaagggcc atgccacggc gaaattcgac gtcgagaccg gcgcgcaggc caaggcgaaa       960
     tcgaacgcgc ccagctatac ctcggtcttt gcccgcgcgc tggtcgatca ggccagccgc      1020
     gacgcccgca tcgtcgccgt caccgccgcc atgccggacg ggaccggctt gaacctgatg      1080
     gccgagcgtt tcccgcgccg ctgcttcgac gtgggcattg ccgagcagca tgccgtgact      1140
     ttctcggccg ggctggcggc gggggggatg aagccgttct gcgcgcttta ttcgaccttc      1200
     ctgcagcgcg gctacgacca ggtcgtgcac gacgtggcga tccagcgcct gccggtgcgc      1260
     tttgccatcg accgcgccgg cctggtcggc gccgatggcg cgacccatgc cggcgcatat      1320
     gacgtcgcat tcctggcgaa cctgcccggc atggtggtca tggctgccgc cgacgaggcg      1380
     gaactggtcc atatggtcgc caccgcggcg gcccatgacg aggggcccat tgctttccgc      1440
     tatccgcgcg gcgagggcac cggcgtcgag atgcccgagc gcggcgaggt actggtgatc      1500
     ggcaagggca gggtcatggc cgagggcaag ggcgtcgcca tcctgtcctt cggcacccgg      1560
     ctgtcggaag taatgcgcgc gcgcgagtcg ctggcggcgc gtggcgtcag cccgacggtg      1620
     gtcgatgccc gcttcgccaa gcctctggac cgcgacctga tcctgcgcct tgcccgcacg      1680
     catgaggcgc tgatcaccat cgaagagggc gcggtcggcg gcttcggcag cctggtcgcg      1740
     caactgcttg cggacgaggg cgtgttcgac ggcgggctgc gcttccgcca gatggtgctg      1800
     cccgacacat tcatcgacca tgccagcccc gaggccatgt atcgcgaggc ccgcatgtcc      1860
     gcccccgaca tcgaggccaa ggtgctggaa gtcctgggcg tggcgctggc gaaacgtgcc      1920
     tga                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page