(data stored in ACNUC7421 zone)

EMBL: CP000489.PE398

CP000489.PE398       Location/Qualifiers
FT   CDS_pept        371378..371998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0401"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; KEGG: sil:SPO0041
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68515"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ21"
FT                   /protein_id="ABL68515.1"
FT                   /translation="MLRILLTGLVLAAPLAVQAQDYLPNLFDVTVVETWDKLNVREAPD
FT                   GQAKIIGRLASTAKGVELLDRDASGKWGLVNVGETTGWVALRFLKPQATVWKPAELPLA
FT                   LRCSGTEPFWSVKTVQKGLIFSEPDAPERQLSLRKVMDRGIEGEPTRGIIAGDDKGRLT
FT                   AFMRPEQCSDGMSDRGHALAVSVILDGQEQPSRMLTGCCSIAP"
     atgctgcgta tcctattgac cggcctcgtc cttgccgcgc cgctggcggt gcaggcgcag        60
     gattatctgc cgaacctgtt cgacgtcacc gtggtcgaga cctgggacaa gctgaacgtg       120
     cgcgaggcgc cggacggcca ggccaagatc atcggcaggc ttgcctcgac cgccaagggc       180
     gtcgagttgc tggaccgcga cgcctcgggc aagtgggggc tggtgaacgt gggcgagacc       240
     acgggctggg tggcgctgcg ctttctcaag ccgcaggcca cggtctggaa gccggccgaa       300
     ctgccgctgg cgctgcgttg cagcggaacc gagcccttct ggtcggtcaa gacggtgcag       360
     aaagggctga tcttcagcga gcccgatgcg ccggagcgcc agctttcgct gcgcaaggtc       420
     atggaccgcg gcatcgaggg cgagcccacg cggggcatca tcgccggcga tgacaagggg       480
     cggctcacgg cgttcatgcg gcccgagcaa tgttcggacg gcatgtcgga ccgcggccat       540
     gcgctggcgg tcagcgtgat cctggacggg caagagcagc cctcgcgcat gttgacgggc       600
     tgctgctcga tcgcgcccta g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page