(data stored in ACNUC7421 zone)

EMBL: CP000489.PE4

CP000489.PE4         Location/Qualifiers
FT   CDS_pept        3298..5157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0004"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: rde:RD1_0432
FT                   glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68121"
FT                   /db_xref="GOA:A1AXX7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXX7"
FT                   /protein_id="ABL68121.1"
FT                   /translation="MKQFDVIVIGGGHAGVEAAMAAARMGVKTALVTLHRDDIGTMSCN
FT                   PAIGGLGKGHLVREIDALDGVMGKLADTAGIQFRLLNRRKGPAVQGPRAQADRKLYRSA
FT                   AAKIVAGQDGLSLILGEAAELLHERGQVTGLRLADDSELQARQIILTTGTFLNGLIHIG
FT                   EISRQAGRWGGSTSVTLAASLRPLNLPLGRLKTGTPPRILRQSIDWESLHQQPGDEEPV
FT                   MFSYLNTVPEAPQVSCAITHTNPDTHRIIRENLARSAMYGGRIDGVGPRYCPSIEDKVV
FT                   RFADKESHQIFLEPEGLDSDLVYPNGISTSLPEDIQLAYVRSIRGLERAQIAQPGYAVE
FT                   YDYVDPRALAASLEVKNLSGLFLAGQINGTTGYEEAAAQGLVAGLNAALKAQGREALHF
FT                   SRSQSYIGVMIDDLTTRGVSEPYRMFTSRAEFRLSLRADNADQRLTPFGIDIGCVGQER
FT                   RAAFSEKMRRYTAARDRAESVSFTPTELSRSGIEVRHDGARRSLFALLAQQEIPQDQVL
FT                   ALDDQLVLQDPAIIRQLATDALYHQYTDRQGKDAELLRKEEAVAIPAEFDYDALSGLSN
FT                   ELKFKLNQHRPATLAAAANIEGMTPAALTLILAVIRAGNRRSA"
     gtgaaacaat tcgacgtaat cgtgattggt ggaggccatg ccggcgtgga agcggccatg        60
     gctgcggccc gcatgggtgt gaaaaccgcg ctggtcacgt tgcaccgcga cgatatcggc       120
     accatgtcct gcaaccctgc gatcgggggg ctgggaaagg gccatctggt ccgagaaatc       180
     gacgcgctcg atggagtcat ggggaaactc gccgataccg ccggcattca gtttcggctt       240
     ttgaaccgac gcaagggtcc tgccgtgcaa gggcctcgtg cacaggcgga tcgcaagctt       300
     tatcgttcgg ctgcggcgaa gatagtggcc ggacaggacg gtctgtctct gatcctgggc       360
     gaggctgccg aattactgca tgagcgtggc caagtcaccg gcttgcggct ggccgatgat       420
     agcgaattgc aggcgcggca gatcatcctg accaccggaa cattcctgaa cggtttgatt       480
     cacatagggg aaatcagccg ccaagcaggc cgctggggcg ggtccacctc cgtgaccttg       540
     gccgcttcgc ttcgtccgtt gaacctgccg ctggggaggt tgaagaccgg aacgcctccg       600
     cgcattctgc ggcagagcat cgattgggag agcctgcatc agcagccggg tgatgaagaa       660
     ccggtgatgt tctcttacct gaatacggtg ccggaagctc cgcaagtcag ctgcgcgatc       720
     acgcatacca accccgacac acaccgaata attcgcgaaa accttgcgcg atcagcgatg       780
     tatggggggc ggatcgatgg cgtgggaccg cgatactgcc cttcgattga ggacaaggtc       840
     gtccgttttg ccgacaagga atcgcatcag atcttcctgg agccggaagg tctggatagc       900
     gatcttgtct atccaaacgg gatttcgacg tctttgccgg aagatatcca actcgcttac       960
     gtccgttcaa tccgcggtct cgagcgggcg cagatcgcgc agccgggcta tgcggtggaa      1020
     tatgactatg tcgacccgcg tgccttggct gcgtcgctgg aggtcaagaa tttgtcaggg      1080
     ctgttcctgg ccgggcagat caacggcacg acgggttatg aagaggcggc ggcgcaaggg      1140
     ctggtcgctg gtctcaatgc ggcattgaag gcgcaaggcc gcgaggcgtt gcatttcagc      1200
     cggtcgcaaa gctatatcgg ggtgatgatc gatgatctca ccacgcgcgg tgtcagcgag      1260
     ccctatcgca tgttcacatc gcgtgccgaa ttccggctct cgcttcgggc ggataacgct      1320
     gatcagcgtt tgacgccttt tggtatcgat attggctgtg tcggccagga gcgcagagcg      1380
     gcattctctg aaaagatgcg gcgctatact gcggcgcggg accgtgccga gtccgtatcc      1440
     tttactccga cggagctttc ccgttcgggg atcgaggtgc gtcacgatgg ggctcgacgc      1500
     agcctgtttg ctctgctggc tcagcaggaa ataccgcaag atcaagtcct tgcactggat      1560
     gatcagcttg tattgcaaga tcccgccatc atccgccagt tggccacaga tgcgctttat      1620
     catcagtata cggaccgtca gggcaaggat gccgagctgc tccgaaagga agaggcagta      1680
     gccataccag ccgagtttga ttacgacgcg ctttctggcc tgtccaacga actcaaattc      1740
     aagctgaacc aacatcgccc ggcgacgctg gctgccgctg cgaatatcga ggggatgacc      1800
     ccggctgcgc tgaccttgat cctcgccgtg atccgtgccg gcaatcgccg cagcgcctga      1860
//

If you have problems or comments...

PBIL Back to PBIL home page