(data stored in ACNUC7421 zone)

EMBL: CP000489.PE402

CP000489.PE402       Location/Qualifiers
FT   CDS_pept        375573..375872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0405"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: rsp:RSP_1388 DNA-binding protein HU, form N"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68519"
FT                   /db_xref="GOA:A1AZ25"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ25"
FT                   /protein_id="ABL68519.1"
FT                   /translation="MAQAASKPMTKTQLVATLADEMGSDKKTAAAALDALSAVVSRTVA
FT                   EGGALTLPGIGKVACRTRPERQVRNPQTQEMMTKPADKVVKVTIAKALKDSVNA"
     atggcccagg ccgcttcgaa accgatgacc aagacccagc tcgtcgccac gctggccgat        60
     gaaatgggca gcgacaagaa gaccgccgcc gcggctctgg acgcgctttc ggccgtcgtg       120
     tcgcgcacgg tcgccgaagg tggcgccctc accctgccgg gcatcggcaa ggtcgcgtgc       180
     cgcacccgcc ccgagcgtca ggtccgcaat ccgcaaaccc aggagatgat gacgaagccc       240
     gccgacaagg tggtcaaggt caccatcgcc aaggcgctga aggacagcgt gaacgcctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page