(data stored in ACNUC7421 zone)

EMBL: CP000489.PE403

CP000489.PE403       Location/Qualifiers
FT   CDS_pept        376017..376937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0406"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_1390 putative transporter, DMT
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68520"
FT                   /db_xref="GOA:A1AZ26"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ26"
FT                   /protein_id="ABL68520.1"
FT                   /translation="MDFRAILMGFGFAVLWASAFTSTRMIVLAAPPLTALVIRFGLSAL
FT                   VAIPLARAMGQSWRLNRTEWRTVILFGLCQNALYLGFSWVAMQYVEASVSAIIASMMPL
FT                   VVAFLGWLLYGERLRPIAVAGLVAGVAGVTLIMGVRLQHGLDVPGVILCLIGMVALTFA
FT                   TLAARGAGGSRNMMMLVGLQMAVGAALLLIPAVLMEWGRPVEWSAGLVWAFAYTVIAPG
FT                   IGATWLWFRLVNRIGAVRAATFHFLSPIFGVGIAAALLGERFGVSDVIGALIVAAGILM
FT                   VQLAKLPAAAPQPSIPAARAIEGRD"
     atggatttca gggccattct gatgggtttc ggctttgcgg tcctttgggc ctcggccttc        60
     acctcgacgc gcatgatcgt cctggccgcc ccgccgctga ccgcgctggt catccgtttc       120
     ggcctgtccg ccctggtggc gattccgctg gcccgagcga tgggccagag ttggcgactc       180
     aacaggaccg aatggcgcac ggtgatcctg ttcggcctgt gccagaacgc gctttacctg       240
     ggcttcagct gggtcgccat gcaatatgtc gaggcctctg tctcggccat catcgcctcg       300
     atgatgccgc ttgtcgtcgc cttcctgggc tggctgcttt atggcgagcg gctgcgcccc       360
     atcgctgtgg ccgggctggt cgcgggcgtt gccggcgtca cgctgatcat gggggtgcgg       420
     cttcagcacg ggctggacgt gccgggggtg atcctgtgcc tgatcggcat ggtggcgctg       480
     acctttgcca cgctggcggc gcgcggggcg ggcggcagcc gcaacatgat gatgctcgtc       540
     ggcttgcaga tggcggtcgg cgccgccctg ctgctgatcc cggccgtgct gatggaatgg       600
     ggtcgcccgg tggaatggag cgcgggcctg gtctgggcct ttgcctatac ggtgatcgcg       660
     cccggcatcg gcgcgacctg gttgtggttc cggctggtca accgcatcgg cgcggtgcgg       720
     gcggcgacct ttcatttcct gtcgccgatc ttcggcgtcg gcatcgccgc ggccctgctg       780
     ggcgaacggt tcggcgtctc ggacgtgatc ggcgcgctga tcgtggcggc gggcatcctg       840
     atggtgcaac tggccaagct gcctgccgcg gcgcctcagc cgtcgatccc tgccgcccgc       900
     gccatcgagg gtcgggactg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page