(data stored in ACNUC7421 zone)

EMBL: CP000489.PE405

CP000489.PE405       Location/Qualifiers
FT   CDS_pept        377546..378247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0408"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein;
FT                   KEGG: hne:HNE_1222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68522"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ28"
FT                   /protein_id="ABL68522.1"
FT                   /translation="MSRTDRLMRLMDALRRLPAPVTAARLAEETGVSRRQLYRDIATLR
FT                   AGGALIDGEAGLGYALTEDPALPPQSFSRLEIEALLLAISGLRTLGDPELTRAGEDALA
FT                   RIIATLPESQGRHAMHTTMRLFRAPAQRPSPQVDMALLRAALWEERSLVIDYLDLHDAA
FT                   TTREIWPLGLSYSDNHMMLLAHCKLREDFRTFHVPRIRAMRPGGTSFRPRRVALVREYI
FT                   SRPCATRPQSG"
     atgtcccgca ccgaccggct gatgcgcctg atggatgcgt tgcgccgcct gcccgcgccg        60
     gtgacggccg cgcggctggc cgaagagacc ggcgtctcgc gccgccagct ttaccgcgac       120
     atcgccacgc tgcgcgctgg cggcgcgctg atcgacggcg aggcggggct gggctatgcg       180
     ctgaccgagg atccggcgct gccgccgcaa agcttttcgc ggctggagat cgaggcgctg       240
     ctgctggcta tttcggggct gcgcacgctg ggcgatcccg aactgacccg cgcgggcgag       300
     gatgcgctgg cccgcatcat cgccaccctg ccggaaagcc agggccgcca tgccatgcac       360
     accaccatgc ggctgtttcg cgcgccggcg cagcgtccca gcccgcaggt ggacatggcg       420
     ctgctgcgcg cggccctgtg ggaagagcgc agcctggtca tcgattatct cgacctgcac       480
     gacgccgcca cgacgcgcga gatctggccg ctgggcctca gctacagcga caatcacatg       540
     atgctgctgg cgcattgcaa gctgcgcgag gatttccgca ccttccatgt gccgcgcatc       600
     cgggccatgc gtcccggcgg caccagcttt cgcccgcgcc gcgtggccct ggtgcgggaa       660
     tatatctcgc gtccctgcgc tactcggccg caatcggggt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page