(data stored in ACNUC7421 zone)

EMBL: CP000489.PE407

CP000489.PE407       Location/Qualifiers
FT   CDS_pept        379720..380193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0410"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   ret:RHE_PE00222 probable transcriptional regulator protein,
FT                   AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68524"
FT                   /db_xref="GOA:A1AZ30"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ30"
FT                   /protein_id="ABL68524.1"
FT                   /translation="MNDKIFSIDEIDNRLLSLLQRDASLSQRELAERVGLSQNACWRRL
FT                   QRLTEAGVLQGSRAVIDAAALGLGLTVFVMIRTRHHDDAWARRFRARIESLPQITEFHR
FT                   IGGEWDYMAKAVVGGMAGYDALYKRLIADMDLERVTGVFSMETIFEGRPLAPA"
     atgaacgaca agatcttttc aatcgatgaa atcgacaacc gcctgttgtc gctgttgcaa        60
     cgcgatgcca gcctgtcgca gcgcgagctg gccgagcggg tgggcctgtc gcagaatgcc       120
     tgctggcggc ggttgcagcg gttgaccgag gccggcgtgc tgcaaggcag ccgcgcggtc       180
     atcgatgcgg ctgcgttggg gctggggctg acggtctttg tcatgatccg cacccggcat       240
     cacgacgacg cctgggcgcg gcgctttcgc gcccgcatcg aatcgctgcc gcagatcacc       300
     gagttccacc gcatcggcgg cgaatgggat tacatggcca aggcggtggt gggtggcatg       360
     gcgggctatg acgcgctcta caagcgcctg atcgccgaca tggatctgga acgcgtgacc       420
     ggcgttttct cgatggagac gatcttcgag ggccggccgc tggcgccggc ttga             474
//

If you have problems or comments...

PBIL Back to PBIL home page