(data stored in ACNUC7421 zone)

EMBL: CP000489.PE408

CP000489.PE408       Location/Qualifiers
FT   CDS_pept        380224..381213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0411"
FT                   /product="putative exonuclease protein involved in mRNA
FT                   processing"
FT                   /note="KEGG: ret:RHE_CH01163 putative exonuclease protein
FT                   involved in mRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68525"
FT                   /db_xref="GOA:A1AZ31"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ31"
FT                   /protein_id="ABL68525.1"
FT                   /translation="MRADSILFPTEAGLFCPEGGFHIDPLKPVERALITHGHSDHARFG
FT                   HGAVMATAETLEIMRLRMGDGFAGATQVADGEMRIGGVTVGFHPAGHVLGSSQIAVEAG
FT                   GRRIVVSGDYARQPNPTCAPFQPVPCDVFVTEATFGLPVFRFPDPTTQVVKLLSSMAEF
FT                   PDRPHLIGAYALGKAQHVIALMREAGYDAPIAIHGALKVLCDFYAARGVELGELVPATA
FT                   EDVAAQLVIAPPSAFASPWVQRFRDPVIGFASGWMAVRARARQRGVELPLVISDHVDWP
FT                   ALTGTLAELAPSEVWVTHGAEDGVIRWCELAQIPARPLRLVGYEDEAE"
     atgcgcgccg attccatcct gttcccgacc gaggccggtc ttttctgccc cgagggcggc        60
     tttcacatcg acccgctgaa gccggtcgag cgcgcgctga tcacgcatgg ccattccgac       120
     catgcccgct ttggccatgg cgcggtcatg gccactgccg agacgctgga gatcatgcgg       180
     ctgcgcatgg gcgacggctt tgccggtgcg acgcaggtgg ccgatggcga gatgcgcatc       240
     ggcggcgtca ccgtcggctt tcacccggcc ggacatgtgc tggggtcaag ccagatcgct       300
     gtcgaggccg ggggccggcg tatcgtcgtc tcgggcgatt atgcgcgcca gccgaacccg       360
     acctgcgcgc cgttccagcc ggtgccctgc gacgtcttcg tgaccgaggc gacctttggc       420
     ctgccggtgt tccgttttcc cgacccgacg acgcaggtgg tgaagctgct ctccagcatg       480
     gccgagtttc ccgaccgccc gcatctgatc ggcgcctatg cgctgggcaa ggcgcagcat       540
     gtcatcgcgc tgatgcgcga ggccggctat gacgcgccca ttgccatcca tggcgcactg       600
     aaggtgctgt gcgatttcta tgcggcccgc ggtgtcgagc tgggcgagtt ggtgccggcg       660
     accgccgagg atgtcgcggc gcaactggtg atcgcgccgc catcggcctt tgccagcccc       720
     tgggtgcagc ggttccgcga cccggtgatc ggctttgcct cgggctggat ggcggtgcgg       780
     gcgcgggcgc ggcagcgcgg ggtcgagctg cccctggtca tcagcgacca cgtcgattgg       840
     ccggcgctga ccggcacgct ggcggaactg gcgccatccg aggtctgggt cactcatggc       900
     gccgaggacg gcgtgatccg ctggtgcgaa ctggcgcaga tccccgcccg gccgctgcgg       960
     ctggtgggtt acgaggacga ggcggaatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page