(data stored in ACNUC7421 zone)

EMBL: CP000489.PE410

CP000489.PE410       Location/Qualifiers
FT   CDS_pept        382751..385186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0413"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: rsp:RSP_0658
FT                   probable ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68527"
FT                   /db_xref="GOA:A1AZ33"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ33"
FT                   /protein_id="ABL68527.1"
FT                   /translation="MILPPEFQDWFVRQGWQPHPHQLALLAAEGDSLLIAPTGGGKTLA
FT                   GFLPSLVDLARVGRSQDGYLENGKGARTGLHTLYVSPLKALTADIGRNLARPVAELGLE
FT                   IRVEDRTGDTGQGQRRRQRVDPPEILLTTPESLALMLSYPEAPAIFGGLRRVVLDELHA
FT                   LAESKRGDQLMLGLARLRRLAPGLRVTGLSATVEDPQALAGFMAGAALVTVVEADPGPD
FT                   PDIAMLPTAKPAPWSGGGGHYAIPEVLEAVKGARTTIIFINTRAQAELFFQALWAENDE
FT                   NLPIGLHHGSLAREQRARVEAAMAAGELRAVVATGSLDLGIDWGAVDLVIQVGAPKNVK
FT                   RLVQRIGRANHRYNAPSRARIVPANRFEQIECVAALEAVRERDLDGDRRGPGPLDVLCQ
FT                   HIGLTACAAPFDADALFAEVVTAGPYRGLSRADFDACLDFAATGGYALRAYDRWQRLVL
FT                   RAGLWQLRDPRAAKLLRMNVGTIVEAEMMKVRLRGRGGAPLGEVEEAFAASLTHGDSFL
FT                   IGGRVVRMDAMREMVIEVTPDPTRQPKIAVYSGVKLAMSTQLSHRVLALIGDPARHGAL
FT                   PAQTREWLDLQAQVSALPEPGLLLSESFPHAGLWHFALYGFAGRNALQTLGLLLTREME
FT                   DEGLGPLGFLSTDYALLVWSLDAVRDPAPLLDRARLRAGLGDWLGENAVMKRTFRNVAT
FT                   VAGLTQRNMPGQRKTGRQATFSSDILYDTLRKYDPGHLMLRITAEEAGRGLVDFGRIEE
FT                   MLDRSPRREHRMLERVSPMAAPLLLEVGRVPIRGEGRERLAQIEAEALMAEAGLEGIA"
     gtgatcctgc cgcccgagtt ccaggactgg ttcgtgcggc agggctggca gccgcatccg        60
     catcagctgg ccctgctggc ggccgagggc gacagcctgc tgatcgcgcc gaccggcggc       120
     ggcaagacgc tggcggggtt tctgccctcg ctggtggacc tggcgcgggt ggggcggtcg       180
     caagatgggt atttggaaaa tggaaaaggc gccaggacgg ggctgcatac gctttacgtc       240
     tcgccgttga aggcgttgac ggcggatatc ggccgcaacc tggcccggcc ggtggccgag       300
     ctggggttgg agattcgggt cgaggaccgg accggcgaca ccgggcaagg ccagcgccgc       360
     cgccagcgcg tcgatccgcc cgagatcctg ctgacgacgc cggaaagcct ggccctgatg       420
     ctgagctatc ccgaggcgcc ggcgatcttt ggcggcttgc gccgggtggt gctggacgaa       480
     ttgcacgcgc tggcggaaag caagcgcggc gaccagttga tgctggggct ggcccggctg       540
     cggcggctgg cgcccgggtt gcgggtgacg gggctgtcgg cgacggtcga ggatccgcag       600
     gctttggcgg ggttcatggc gggtgctgct ctggttaccg tggtcgaggc cgatcccggc       660
     cccgatcccg acatcgccat gctgcccacc gccaagcctg cgccatggtc cggcggcggc       720
     gggcattacg ccatccccga ggtgctggag gcggtgaaag gcgcgcgcac gacgatcatc       780
     ttcatcaaca cccgcgcgca ggccgagctg ttcttccagg cgctgtgggc cgagaatgac       840
     gagaacctgc ccatcggcct gcatcacggc agcctggcgc gcgagcagcg ggcgcgggtc       900
     gaggcggcga tggcggcagg cgaactgcgc gccgtggtgg cgaccggcag cctggacctg       960
     ggcattgact ggggcgccgt cgatctggtg atccaggtcg gcgcgcccaa gaacgtcaag      1020
     cggctggtcc agcgtatcgg ccgggcgaac catcgctata acgctccgtc cagggcgcgg      1080
     atcgtgccgg cgaaccgttt cgagcagatc gaatgcgtgg ccgctctgga ggcggtgcgg      1140
     gagcgcgacc tggacggcga tcggcgcggg ccggggccgc tggacgtgct atgccagcat      1200
     atcgggctga ctgcctgcgc cgcgcccttc gatgccgatg cgctttttgc cgaggtcgtt      1260
     accgccggcc cctatcgtgg gctgagccgg gcggatttcg atgcctgcct ggatttcgcc      1320
     gcgaccgggg gctatgcgct acgcgcctat gaccgctggc agcggctggt gctgcgggct      1380
     gggctgtggc agctgcgcga cccgcgggcg gcgaagctgt tgcgcatgaa tgtcggcacc      1440
     atcgtcgagg ccgagatgat gaaggtccgg ctgcgcggcc gcggcggtgc gcctttgggc      1500
     gaggtcgagg aggcattcgc cgccagcctg acccacggcg acagcttcct gatcggcggc      1560
     cgggtcgtgc gcatggatgc gatgcgcgag atggtgatcg aggtcacgcc cgacccgacc      1620
     cgacagccca agatcgcggt ctattccggc gtcaagctgg ccatgtcaac gcagctttcc      1680
     catcgcgtgc tggcgctgat cggcgatccg gcgcggcacg gcgccttgcc ggcgcagacg      1740
     cgggaatggc tggatttgca ggcccaggtc tcggccctgc cggaaccggg gctgttgctg      1800
     tcggaaagct ttccccatgc gggcctgtgg catttcgcgc tttacggctt tgccggccgc      1860
     aatgccttgc agacgctggg cctgctgctg acccgcgaga tggaggacga ggggctgggg      1920
     cctctgggtt tcctgtccac cgattacgcg ctgctggtct ggtcgctgga cgcggtgcgc      1980
     gatcccgcgc cgctgttgga ccgggcgcgg ctgcgggcgg gcctgggcga ctggttgggc      2040
     gagaatgcgg tgatgaagcg caccttccgc aatgtcgcca ccgtcgccgg gctgacccag      2100
     cgcaacatgc cggggcagcg aaaaaccggg cggcaggcga ccttttccag cgacattctc      2160
     tatgacacgc tgcgcaaata cgatcccggc cacctgatgc tgcgcatcac cgccgaggag      2220
     gcggggcggg gccttgtcga tttcggccgg atcgaggaga tgctggaccg ctcgccccgg      2280
     cgcgagcatc ggatgctgga gcgggtctcg cccatggccg cgcccctgct gctggaggtc      2340
     ggccgggtgc cgatccgcgg cgaggggcgc gagcggctgg cgcagatcga ggccgaggcg      2400
     ctgatggccg aggccgggct ggaagggatc gcatga                                2436
//

If you have problems or comments...

PBIL Back to PBIL home page