(data stored in ACNUC7421 zone)

EMBL: CP000489.PE412

CP000489.PE412       Location/Qualifiers
FT   CDS_pept        complement(385901..386668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0415"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: mlo:mll1390 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68529"
FT                   /db_xref="GOA:A1AZ35"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ35"
FT                   /protein_id="ABL68529.1"
FT                   /translation="MCAVLVKASLTAGAVASLALGTALAANAGGYTPPVVDTDVTAPVV
FT                   ESAPVGDWAGAYAGLTLGYAFGGDDRVGFTEVDTGTYLGDAGKLELGGANAGLHVGYRW
FT                   QRDRWVFGPELGFEAGNIKDTITFDNQLGGSTDVSSKIRNVLALRLKTGYALRPDLLLY
FT                   GIAGIARADVEYKVAGTDGSGGSMSESRDFKSNGYIVGLGVERKLSDRMSVTGEYEYAN
FT                   FGKTTRTFQVDGGVSTQATPDYHNVKLGLNFKF"
     atgtgcgctg ttcttgtgaa agcttccctg accgctgggg ccgtggcctc gctggccctc        60
     ggcacggctc tggccgcgaa tgcgggcgga tacacgcccc ctgtcgttga taccgacgtc       120
     acggccccgg tcgtcgaaag cgcgccggtc ggcgattggg cgggtgccta tgccggcctg       180
     acgctgggct atgcctttgg cggcgacgac cgcgtcggat tcaccgaagt cgacacgggc       240
     acctatctgg gcgatgccgg gaaacttgag cttggcggcg ccaatgcggg cctgcatgtg       300
     ggttatcgct ggcaaaggga tcgctgggtc ttcggccccg aactcggctt cgaggcgggc       360
     aatatcaagg acacgatcac cttcgacaat caacttggcg gctcgaccga tgtctcgtcg       420
     aagatcagga acgtcctcgc actgcgcctg aagaccggct atgcgctgcg tcccgatctt       480
     ctgctttacg gcatcgccgg catcgcgcgc gccgacgtcg aatacaaggt tgcgggcacc       540
     gatggcagcg gcggctcgat gagcgagagc cgggacttca agagcaatgg ctatatcgtc       600
     ggccttggcg tcgagagaaa gctcagcgac cgcatgtcgg tgacgggcga atatgaatat       660
     gccaacttcg gcaagaccac ccggactttc caggttgacg gaggggtctc gacccaggcc       720
     actcctgatt accacaacgt gaaactcggc ctgaacttca agttctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page