(data stored in ACNUC7421 zone)

EMBL: CP000489.PE413

CP000489.PE413       Location/Qualifiers
FT   CDS_pept        complement(386880..389318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0416"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: rsp:RSP_1346 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68530"
FT                   /db_xref="GOA:A1AZ36"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ36"
FT                   /protein_id="ABL68530.1"
FT                   /translation="MTEPAPQTSDYGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VTEVVDNGIDEALAGHADFVRVKIHADGSVSVRDNGRGIPVDMHPTEGVSAAEVIMTQL
FT                   HAGGKFDQNSYKVSGGLHGVGVSVVNALSDWLELRIWRGGKEHYARFENGDTVEHLRVV
FT                   GDAEPGEKGTEVRFLASSKEDRPDGTFLNREYSYKVLENRLRELAFLNSGVRIILEDER
FT                   PAEPLRTELYYEGGVREFVKFIDRSKTPVMPEPIFITGERNGIGIEVAMWWNDSYHETV
FT                   LPFTNNIPQRDGGTHLAGFRGALTRVINNYAQSSGAARKEKVDFTGDDAREGLTCVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPAVEGLIGEKLAEWFEENPAEAKSILGKIIEAALAREA
FT                   ARKARELTRRKTAMDVASLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRSRQNQAV
FT                   LPLRGKILNVERARFDRMLSSDQIGTLITALGTGIGRDEFNLDKLRYHKIVIMTDADVD
FT                   GAHIRTLLLTFFFRQMPELIEAGHLYIAQPPLYKVSRGRSEVYLKDEAALEDYLIEQGV
FT                   DGASLRLGNGETLTGADLARVVEEARVVRRILRAYPTHYPPHITEQAAIAGALVQGRVD
FT                   ADAQGVANAVAQRLDMIAEEYERGWTGRPTQDAGIRLTRLLRGVEESRTLDGPMLRSAE
FT                   SRRLGAMTDALRDVYGQTAQLIRKDRGIPIHGPMSLLQAIFLEGEKGLSLQRYKGLGEM
FT                   NPEQLWETTLDPAARTMLQVRVEDLGEADDIFTKLMGDVVEPRRDFIQQNALSVENLDI
FT                   "
     atgaccgaac ccgcccccca gacctccgac tacggcgccg attccatcaa ggttctcaag        60
     ggcctggaag cggtgcgcaa gcgccccggc atgtatatcg gcgataccga cgacggctcg       120
     ggcctgcacc acatggtcac cgaggtcgtg gacaacggca tcgacgaggc gctggccggt       180
     catgccgact tcgtgcgggt gaaaatccat gccgatggca gcgtctcggt acgcgacaac       240
     ggccgcggca tcccggtgga catgcacccg accgaggggg tcagcgcagc cgaggtcatc       300
     atgacccagc tgcatgccgg cgggaagttc gaccagaaca gctacaaggt ctcgggcggc       360
     ctgcatggcg tcggcgtttc ggtcgtcaac gcgctgtcgg actggctgga gctgcgcatc       420
     tggcgcggcg gcaaggagca ctacgcccgg ttcgagaacg gcgacacggt cgagcacctg       480
     cgcgtggtcg gcgatgccga gccgggcgaa aagggcaccg aagtgcgctt cctggcctcg       540
     tccaaggagg atcggccgga cggcaccttc ctgaaccgcg aatacagcta caaggtgctg       600
     gaaaaccggc tgcgggaact ggcgttcctg aattcgggcg tgcgcatcat cctggaggac       660
     gagcgccccg ccgagccgct gcggaccgag ctttactatg aaggcggcgt gcgggagttc       720
     gtgaagttca tcgaccgctc gaaaaccccg gtcatgcccg agccgatctt catcaccggc       780
     gagcgcaacg gcatcggcat cgaggtggcg atgtggtgga acgacagcta ccatgaaacg       840
     gtgctgccct ttaccaacaa cattccgcag cgcgacggcg gcacgcatct ggccggcttt       900
     cgcggcgcgc tgacccgcgt catcaacaat tacgcccaat ccagtggcgc ggcccgcaag       960
     gaaaaggtcg atttcaccgg cgacgacgcc cgcgaagggc tgacctgcgt gctgtccgta      1020
     aaggtgccgg acccgaaatt ctccagccag accaaggaca agctggtctc gtccgaggtg      1080
     cgcccggcag tcgagggact gatcggcgag aaactggccg aatggttcga ggaaaacccg      1140
     gccgaggcga aatccatcct cggcaagatc atcgaggcgg cgctggcccg cgaagcggcg      1200
     cgcaaggccc gcgaactgac acgccgcaag accgcgatgg acgtggccag cctgcccggc      1260
     aagctggccg actgccagga aaaggacccg gcgctgtcgg aactgttcat cgtcgagggc      1320
     gactcggccg gtggctctgc caagcagggc cgttcgcgcc agaaccaggc cgtgctgccg      1380
     cttcgcggca agatcctgaa cgtggaacgg gcacggttcg accggatgct gtccagcgac      1440
     cagatcggca cgctgatcac cgcgctgggg accggcatcg ggcgtgacga gttcaacctg      1500
     gacaagctgc gctaccacaa gatcgtcatc atgaccgatg ccgacgtgga cggtgcgcat      1560
     atccgcacgc tgctgctgac cttctttttc cggcagatgc cggagctgat cgaggcaggg      1620
     catctctata tcgcccagcc gccgctctac aaggtcagcc gcggccgctc cgaggtctat      1680
     ctgaaggacg aggcggcgct cgaggattac ctgatcgaac agggcgtcga cggcgccagc      1740
     ctgcggcttg gcaatggcga gaccctgacc ggcgccgacc tggcccgcgt ggtcgaggag      1800
     gcgcgcgtcg tgcgccgcat cctgcgcgcc tatccgacgc attatccgcc ccatatcacc      1860
     gagcaggccg ccattgccgg cgcactggtc cagggccggg tcgatgccga tgcgcagggg      1920
     gtggcgaatg ccgtggcgca acgcctcgac atgatcgccg aggaatatga gcgcggctgg      1980
     accggccgcc cgacgcagga tgccggtatt cgcctgaccc gcctgctgcg cggggtcgag      2040
     gaaagccgca ccctggacgg cccgatgctg cgcagcgccg aaagccggcg gctgggcgcg      2100
     atgaccgatg cgctgcgcga tgtctatggc cagaccgcgc agttgatccg caaggatcgc      2160
     ggcatcccga tccacggccc gatgagcctg ctgcaagcca tcttcctgga aggtgaaaag      2220
     ggtctgtcgc tgcagcgcta caagggcctg ggcgaaatga accccgagca gctttgggag      2280
     accacgctgg acccggcggc acggaccatg ttgcaggtgc gggtcgagga tctgggcgag      2340
     gccgacgaca tcttcaccaa gctgatgggc gatgtggtcg agccgcggcg cgacttcatc      2400
     cagcagaacg ccctgagcgt ggaaaacctg gatatctga                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page