(data stored in ACNUC7421 zone)

EMBL: CP000489.PE415

CP000489.PE415       Location/Qualifiers
FT   CDS_pept        complement(389833..390744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0418"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein; Miro domain protein; KEGG:
FT                   rsp:RSP_1676 GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68532"
FT                   /db_xref="GOA:A1AZ38"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ38"
FT                   /protein_id="ABL68532.1"
FT                   /translation="MTQTRAGFVALIGEPNAGKSTLLNRMVGAKVSIVTHKVQTTRARI
FT                   RGIAMRGASQIVFVDTPGIFRPRRRLDRSMVKAAWGGAADADVILLLIEAHRGLTDGTQ
FT                   AIIDNLRDHAGTTPVVLVINKIDRVKSETLLALSQQVNAAFDFTRTFMISAEKGHGCDD
FT                   LLEWLAGQVPEGPWLYPEDQVADLPMRMIAAEITREKLTLRLHEEIPYQLTVETERWEE
FT                   KKDGSARVDQIVYVARPGHKGIVLGKGGETIKAVGQAARAELAEFMGRPVHLFLQVKVR
FT                   ENWLDEAERYNEMGLDFRDGDA"
     atgacccaga cacgcgcggg cttcgtcgcc ctgatcggcg agccgaatgc cggcaagtcc        60
     accctgctga accggatggt cggggccaag gtctcgatcg tgacgcataa ggtgcagacc       120
     acccgcgccc gcatccgcgg catcgccatg cgcggcgcga gccagatcgt cttcgtcgat       180
     acgcccggca tctttcgccc acgccggcgg ctcgaccgca gcatggtcaa ggcggcctgg       240
     gggggcgcgg ccgatgccga cgtgatcctg cttctgatcg aggcgcatcg cgggctgacc       300
     gacggcacgc aggcgatcat cgacaacctg cgcgaccatg ccgggacgac cccggtggtg       360
     ctggtcatca acaagatcga ccgggtgaaa tccgagacgc tgctggcgct gtcgcaacag       420
     gtcaatgccg ccttcgactt tacccgcacc ttcatgatct cggccgaaaa gggccatggc       480
     tgcgacgacc tgctggaatg gctggccggg caggtgcccg agggcccctg gctctacccc       540
     gaggaccagg tggccgacct gccgatgcgc atgatcgccg ccgagatcac ccgcgaaaag       600
     ctgaccctgc gcctgcacga ggaaatcccc tatcaactga cggtggaaac cgagcgctgg       660
     gaggagaaaa aggacggctc ggcccgggtg gaccagatcg tctatgtcgc ccgccccggc       720
     cacaagggca tcgttctggg caagggcggc gagacgatca aggccgtggg ccaggccgcc       780
     cgcgcggaac tggccgagtt catgggccgc cccgtccacc tgttcctgca ggtgaaggtg       840
     cgcgagaact ggctggacga ggccgaacgc tataacgaga tgggcctcga cttccgcgac       900
     ggcgatgcct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page