(data stored in ACNUC7421 zone)

EMBL: CP000489.PE422

CP000489.PE422       Location/Qualifiers
FT   CDS_pept        complement(396309..397955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0425"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   electron transfer flavoprotein-ubiquinone oxidoreductase;
FT                   KEGG: sil:SPO0316 electrotransfer ubiquinone oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68539"
FT                   /db_xref="GOA:A1AZ45"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ45"
FT                   /protein_id="ABL68539.1"
FT                   /translation="MSEIERESMDYDVVIVGGGPAGLSAAIRLKQVNPELSVVLLEKGS
FT                   EIGAHILSGAVLDTSGLDRLIPDWKDRGAPVTTEVTQDNFYILGPHGQVRVPNWPMPPL
FT                   MNNHGKYIVSMGNVCRWLAEQAEALEVEIFPGMACSQLVYEGDRVVGVVAGEMGLNADG
FT                   SPGPAYEPGMELRGKYVLIAEGVRGSLAKELIGKYDLSAGHEPQKFGLGMKEIWEIDPA
FT                   KARPGTVTHTMGWPLGKNAGGGSFIYHLEGNQVLVGFVVHLNYANPYLYPYMEFQRFKH
FT                   HPLVADLLEGGKRVAYGARAISEGGWQSIPKLTVPGAALLGCSAGLVNVPRIKGNHNAM
FT                   LSGIAAAEAAAKAIAAGREGDELTDYEADLRSGPIARDLKPVRNVKPLWSKLGLWSSLV
FT                   LGGFDMWVANLTGWNPLGTWKHGKTDAQATGKAADFQPIDYPRPDGKLSFDRLTNVAFS
FT                   FTNHEESQPCHLKLKDPAVPIAVNLPLYAEPATRYCPAGVYEVLEGEGGPRFQINFQNC
FT                   VHCKTCDIKDPSQNINWTTPQGGDGPNYPNM"
     atgtccgaaa ttgaacgcga gtcgatggat tacgacgtgg tgatcgtcgg cggcgggcct        60
     gcgggcctgt cggcggcgat ccggctgaag caggtgaacc ccgagctttc cgtggtgctg       120
     ctggagaagg gctccgagat cggcgcgcat atcctctcgg gcgcggtgct cgacacttcg       180
     ggcctcgacc ggctgatccc ggactggaag gacaggggcg ccccggtcac caccgaggtc       240
     acccaggaca acttctacat cctcggcccg catggccagg tccgggtgcc gaactggccc       300
     atgccgcccc tgatgaacaa tcacggcaaa tacatcgtct cgatgggcaa tgtctgccgc       360
     tggctcgccg agcaggccga ggcgctggaa gtcgagatct tccccggcat ggcctgctcg       420
     caactggtct acgagggcga ccgcgtcgtc ggcgtcgtgg ccggcgagat ggggctgaat       480
     gccgacggct cccccggccc ggcctacgag cccggcatgg agctgcgcgg caaatacgtg       540
     ctgatcgccg agggcgtgag gggcagcctc gccaaggagc tgatcggcaa atacgacctc       600
     tcggccggcc atgagccgca gaaattcggc ctcggcatga aggagatctg ggagatcgac       660
     ccggccaagg cccgccccgg caccgtcacc cacaccatgg gctggccctt gggcaagaac       720
     gccggcggcg gcagcttcat ctatcacctc gagggcaacc aggtgctggt cggcttcgtc       780
     gtgcacctga actacgccaa tccctatctc tatccctaca tggagttcca gcgcttcaag       840
     caccacccgc tggtcgcgga cctgctggaa ggcggcaagc gcgtggctta cggcgcccgc       900
     gccatctccg agggcggctg gcagtcgatc cccaagctga ccgtgccggg ggcggcgctg       960
     ctcggttgct cggccgggct ggtgaacgtg ccgcgcatca agggcaacca caatgccatg      1020
     ctgtcgggga tcgccgcggc cgaggcggca gccaaggcca tcgccgcggg ccgcgagggc      1080
     gacgagctca cggactacga ggccgacctg cgttccggcc ccatcgcccg cgacctgaag      1140
     ccggtcagga acgtcaagcc gctgtggtcg aagctggggc tgtggtcttc gctggtgctc      1200
     ggcggcttcg acatgtgggt ggcgaacctg accggctgga accccttggg cacctggaag      1260
     cacggcaaga cggatgcgca ggccaccggc aaggcggcgg atttccagcc catcgactat      1320
     ccgcgcccgg acggcaagct cagcttcgac cggctgacca acgtggcgtt ttccttcacc      1380
     aatcacgagg aaagccagcc ctgccacctg aagctgaagg accccgcggt gccgatcgcg      1440
     gtgaacctgc cgctttatgc cgagccggcg acccgctatt gcccggccgg ggtctacgag      1500
     gtgctggagg gcgagggcgg cccgcgcttc cagatcaact tccagaactg cgtgcattgc      1560
     aagacctgcg acatcaagga ccccagccag aacatcaact ggacaacacc ccagggcgga      1620
     gacggaccca actacccgaa tatgtga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page