(data stored in ACNUC7421 zone)

EMBL: CP000489.PE428

CP000489.PE428       Location/Qualifiers
FT   CDS_pept        complement(401447..402094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68545"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ51"
FT                   /protein_id="ABL68545.1"
FT                   /translation="MQRRAFLALALPAALAACGADNKWASDEAIRRARYVSDEPPSITL
FT                   FSVIGIPRGEGGHSALMINGSQRVIYDPAGSWEHPAIPERHDVLYGITPNFRNFYIDYH
FT                   ARSTYWVAEDTVRVPLSVADAAIRSVERQGASNKSFCAVNTGKALSRVPGFEGAPTGFS
FT                   VLKLREWFLTLPGVTSRRHMDGDPANNHDVLLRQKSGSITGYGRDGQLHVMR"
     atgcaaaggc gtgccttcct tgcgctggcg ctgccggccg cgcttgcggc ctgcggtgcc        60
     gacaacaaat gggccagcga cgaggcgatc cgccgcgcgc gctatgtctc ggacgagccg       120
     ccctcgatca cgctgttcag cgtcatcggc atccctcgcg gcgagggcgg gcattccgcg       180
     ctgatgatca acggcagcca gcgggtgatc tacgacccgg ccggcagctg ggaacatccg       240
     gcgatccccg agcggcacga cgtgctttac ggcatcacgc cgaacttcag gaacttctac       300
     atcgactacc acgcgcgctc gacctactgg gtggccgagg acacggtgcg ggtgccgctg       360
     tccgttgccg atgccgcgat tcgctcggtc gagcggcagg gcgcctcgaa caagagcttc       420
     tgcgccgtca acaccggcaa ggcgctgagc cgcgtgccgg gcttcgaggg cgcgccgacc       480
     gggttctcgg tgctcaagct gcgcgaatgg ttcctgaccc tgccgggcgt gacctcgcgc       540
     cggcacatgg acggcgaccc ggccaacaac cacgacgtgc tgctgcgcca gaaaagcggc       600
     tcgatcaccg gctatggccg cgacggccag cttcacgtga tgaggtaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page