(data stored in ACNUC7421 zone)

EMBL: CP000489.PE430

CP000489.PE430       Location/Qualifiers
FT   CDS_pept        complement(402332..403354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0433"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rsp:RSP_0741 putative metallo-beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68547"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ53"
FT                   /protein_id="ABL68547.1"
FT                   /translation="MIRSEAHNPPAEGEAHEIAPGVFWFQLPLPFKPDTVNAYAFRDAD
FT                   GWTVVDTGLDTRRTRAIWQGILQGPLAGAPVVRLIATHHHIDHIGLAGWFQAQGAELWT
FT                   SRASWLMARMGILDVQERPTPQAVAFWRQAGMPPELLDERSHERPFNSADVCAPLPPGY
FT                   RRLSEGQQVTFGERRWVVRMGHGHAPEHVTLWSLDDDLVIGGDQMLATISPNLGVYPTE
FT                   PEADTVGDWLESCDRLAEYARPEQLVLPGHKLPYRGLPTRLRQLATNQRAALDRMLEGL
FT                   RQEPLSTVGCFPLLYRRQIAKPEFGLALAEAVGHVNHLRATGQVWPVGKTETGAVLWGA
FT                   "
     gtgatacgca gcgaagcaca taaccccccg gccgagggcg aggcgcatga gatcgccccc        60
     ggcgtgttct ggttccagct tcccctgccc ttcaagcccg atacggtcaa cgcctatgcc       120
     tttcgcgacg cggatggctg gacggttgtg gataccggcc tggacacccg ccgcacccga       180
     gccatctggc agggcatcct gcaagggccg ctggccggcg ccccggtcgt ccggctgatc       240
     gccacccatc accacatcga ccatatcggc ctggccggct ggttccaggc gcagggggcc       300
     gagctttgga cctcgcgcgc gtcctggctg atggcacgga tgggcattct cgacgtgcag       360
     gaacgcccga cgccgcaggc cgtcgccttc tggcgccagg ccggcatgcc gcccgaactg       420
     ctggacgagc gcagccacga gcgtcccttc aacagcgccg atgtctgcgc gccgctgccg       480
     cccggctatc gccggctgtc cgagggccaa caggtgacgt tcggcgagcg gcgctgggtc       540
     gtgcgcatgg gccatggcca cgcgccggaa catgtcacgc tgtggtcgct ggacgacgac       600
     ctggtgatcg gcggcgacca gatgctggcg acgatctcgc ccaatctcgg cgtctatccg       660
     acagagcccg aggccgatac cgtcggcgac tggctggaaa gctgcgaccg gctggcggaa       720
     tacgcccggc ccgaacaact ggtcctgccc gggcacaagc tgccctatcg cggcctgccg       780
     acccggctgc gccagctggc caccaaccag cgcgccgcgc tggatcggat gctggaaggg       840
     ctgcggcagg aaccgctcag caccgtgggc tgcttcccgc tgctgtatcg ccgccagatc       900
     gccaagccgg aattcggcct cgcgctggcc gaggcggtcg ggcatgtcaa ccacctgcgc       960
     gcgaccggcc aggtgtggcc ggtgggcaag accgagaccg gcgcggtgct ttggggggcg      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page