(data stored in ACNUC7421 zone)

EMBL: CP000489.PE432

CP000489.PE432       Location/Qualifiers
FT   CDS_pept        405159..406109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0435"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain;
FT                   KEGG: rsp:RSP_0743 putative translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68549"
FT                   /db_xref="GOA:A1AZ55"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ55"
FT                   /protein_id="ABL68549.1"
FT                   /translation="MQTLILGHDPRGVRTAAELLAQGEPVAIPTETVYGLAGDARNPRA
FT                   VARIYEAKGRPSFNPLIVHVPDLAAAGRIADFDDAALALARAFWPGALTLVLPLRPDAG
FT                   IASLVTAGLDTVAIRVPAHPAAQEVLRVFGGPLAAPSANPSGRISPTTAAHAADPETGL
FT                   GGRIAAVLDAGACPVGVESTIVGWVDGQPALLRPGGVAAEAIEAVLGRPLARPEADPDA
FT                   PTAPGQLTSHYAPRASLRLNADAARPGEVLIGFGPVAGEMTLSETGDLTEAAARLFDLL
FT                   HRADAEERPIAVAPVPERGLGAAINDRLRRAAAPR"
     atgcagacgc tgatccttgg ccacgacccc cggggcgtgc gcaccgccgc cgagctgctg        60
     gcgcagggcg agccggtcgc catcccgacc gaaacggtct acgggctggc cggcgacgcc       120
     cgcaatcccc gcgccgtcgc gcgcatctat gaggccaagg gccggcccag cttcaacccg       180
     ctgatcgtgc atgtccccga tctggcggcg gccgggcgca tcgcggactt cgacgatgcc       240
     gcgctggcac tggcgcgggc cttctggccc ggtgcgctga cgctggtgct gccgctgcgg       300
     ccggacgccg gcatcgcctc gctggtgacg gcggggctgg acacggtggc gatccgcgtg       360
     ccggcgcatc cggcggcgca agaggtgctg cgcgtcttcg gcgggccgct ggcggcgccc       420
     tcggccaacc catcggggcg gatcagtccg accacggccg cccatgccgc cgaccccgag       480
     accgggctgg gcgggcgcat cgcggcggtg ctcgatgcgg gcgcctgtcc ggtcggcgtg       540
     gaatcgacta tcgtcggctg ggtggatggc cagcctgcgc tgctgcgccc cggcggcgtc       600
     gcggccgagg cgatcgaggc ggtgctgggc cggccgctgg cccggcccga ggccgatccc       660
     gacgcgccga ccgcaccggg gcagctgacc agccattacg cgccgcgtgc cagcctgcgg       720
     ctgaacgccg atgccgcccg gccgggcgag gtgctgatcg gctttggtcc cgtcgcgggc       780
     gagatgacgc tgagcgaaac gggcgacctg accgaagccg cggcgcggct gttcgacctg       840
     ctgcaccgcg ccgatgccga ggagcggccc atcgccgtcg cgccggtgcc cgagcggggg       900
     ctgggggctg cgatcaacga ccggctgcgc cgtgccgccg cgccgcgcta g                951
//

If you have problems or comments...

PBIL Back to PBIL home page