(data stored in ACNUC7421 zone)

EMBL: CP000489.PE433

CP000489.PE433       Location/Qualifiers
FT   CDS_pept        complement(406113..406685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0436"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   sil:SPO0296 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68550"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ56"
FT                   /protein_id="ABL68550.1"
FT                   /translation="MDQSSNLTGKMLIAMPGMRDPRFEQSVILICAHSEDGAMGLVVNR
FT                   PLPEIGFSDLLAQLGIQAGANALDIPVRFGGPVEPGRGFVLHRAPREIELDENRMRITD
FT                   DLAMSTTRDILEDFARGLGPQPAMLALGYAGWGPGQLDSEIRENGWLTSDRGDEIIFGA
FT                   EDAGKWRAALKSLGIDPLMLSPDAGHA"
     atggaccagt cgagcaacct gaccggcaag atgctgatcg ccatgccggg catgcgcgac        60
     cctcgcttcg agcagtccgt gatcctgatc tgcgcccatt ccgaggacgg ggccatgggg       120
     ctggtggtca accggccact gcccgagatc ggcttttccg acctgctcgc ccagcttggc       180
     atccaggccg gcgcgaatgc gctggacatc cccgtccgct tcggcggccc ggtcgagccg       240
     gggcggggat tcgtgctgca ccgcgccccc cgcgagatcg agctggacga gaaccggatg       300
     cgcatcaccg acgacctggc catgtccacc acccgcgaca ttctcgagga tttcgcgcgc       360
     ggcctgggtc cgcagccggc catgctggcg ctcggctatg ccggctgggg tccggggcag       420
     ctcgattcgg agatccgcga aaatggctgg ctgacctcgg accgcggcga cgagatcata       480
     ttcggcgccg aagatgccgg caaatggcgg gcggcactga aatcgctggg catcgacccc       540
     ctgatgctgt cgcccgatgc gggccacgcc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page