(data stored in ACNUC7421 zone)

EMBL: CP000489.PE434

CP000489.PE434       Location/Qualifiers
FT   CDS_pept        406794..407576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_3420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68551"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ57"
FT                   /protein_id="ABL68551.1"
FT                   /translation="MKTLALLFITAAPALAQDLPPGLLSAELLPGWTTSQGHRMTALHL
FT                   RLEPGWKTYWRSPGDAGVPPRFDWGGSQNLGEVRLMWPRPEVIESGGERTLGYHDELVL
FT                   PIEIAPASHAAPVEPRAVVDFGICQDICVPVRVELQAGPPGPMPDPVIEAAIARQPETS
FT                   DRQPECRIARIKDGMQVTATLPAADSARGDEVAMELADDEIWVSAPETHAVGNRLTAQA
FT                   EFVAASGQPFPLDPGSLRVTLIGPDDAVEFQGCRVAGD"
     atgaagaccc ttgccctgct tttcatcacc gccgcgccgg ccctggcgca ggatctgccg        60
     cccggattgc tgtcggccga attgctgccc ggctggacca cctcccaggg ccaccggatg       120
     accgcgctgc acttgcggct ggaaccgggc tggaagacct attggcgcag ccccggcgat       180
     gccggcgtgc cgccgcgctt cgactggggc ggctcgcaga acctgggcga ggtgcggctg       240
     atgtggccgc ggcccgaggt gatcgaatcg ggcggcgagc gcacactggg ctatcacgat       300
     gaactggtgc tgccgatcga gatcgcccca gccagccacg ccgcgccggt cgagcccagg       360
     gcggtggtcg atttcggcat ctgccaggac atctgcgtgc cggtgcgggt ggaattgcag       420
     gccggtcccc ccggcccgat gcccgatccg gtgatcgagg cggccatcgc ccgccagccc       480
     gagacttcgg accgccagcc cgaatgccgc atcgcccgga tcaaggacgg catgcaggtc       540
     accgccaccc tgcctgcggc ggacagcgcc cgcggcgacg aggtggcgat ggagcttgcc       600
     gatgacgaga tctgggtctc ggcccccgaa acgcatgcgg tggggaaccg gctgaccgcg       660
     caggcggaat tcgtcgcggc ctcgggccag ccctttccgc tggaccccgg atcgctgcgc       720
     gtgacgctga tcggccccga cgacgcggtc gagttccagg gctgccgcgt ggcgggggac       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page