(data stored in ACNUC7421 zone)

EMBL: CP000489.PE437

CP000489.PE437       Location/Qualifiers
FT   CDS_pept        409050..410171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0440"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: rsp:RSP_0859 hypothetical protein; TIGRFAM:
FT                   3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68554"
FT                   /db_xref="GOA:A1AZ60"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ60"
FT                   /protein_id="ABL68554.1"
FT                   /translation="MTTYSLLILPGDGIGPEVMAEVRKVIGWFEKSRGLSFDVSEDLVG
FT                   GAAYDKYGKPLADETMAKAQAVDAVLLGAVGGPKYDNLDFSVKPERGLLRLRKEMDLFA
FT                   NLRPAQCFDALADFSSLKREVVAGLDILIVRELTSGVYFGEPRGIHADDNNPDNEGGRV
FT                   GVNTQRYTSGEIRRVARSAFELARKRSNRVCSMEKANVMESGILWREEVQWVHDNEYPD
FT                   VELSHMYADNGAMQLVRNPRQFDVIVTDNLFGDILSDAAAMLTGSLGMLPSASLGAPMA
FT                   NGRPKALYEPVHGSAPDIAGQGKANPIACILSFAMCLRYSFGLGAEADLLEKAVERVLA
FT                   DGVRTGDLMGAEGGKPVSTAEMGDHIVAALSAL"
     atgacgacct attccctgct gatcctgccc ggcgacggca tcggccccga ggtcatggcc        60
     gaggtgcgca aggtcatcgg ctggttcgaa aagagccgcg gcctgtcctt cgacgtcagc       120
     gaggatctgg tcggcggcgc ggcctacgac aaatacggca agcctctggc ggacgagacc       180
     atggccaagg cgcaggcggt cgatgcggtg ctgctgggcg ccgtcggcgg gccgaaatac       240
     gacaatctcg acttttcggt gaagcccgag cgcgggctgc tgcgcctgcg caaggaaatg       300
     gacctgttcg ccaacctgcg ccccgcgcaa tgcttcgacg cgctggccga tttcagctcg       360
     ctcaagcgcg aggtggtcgc gggcctcgac atcctgatcg tgcgcgagtt gacctcgggc       420
     gtctatttcg gcgagccgcg cggcatccat gccgacgaca acaaccccga caacgagggc       480
     ggccgcgtcg gcgtgaacac ccagcgctat accagcggag agatccgccg cgtcgcgcgc       540
     tcggccttcg agctggcccg caagcgcagc aaccgcgtct gctcgatgga aaaggccaat       600
     gtgatggaat ccggcatcct ctggcgcgaa gaggtgcaat gggtgcatga caacgaatat       660
     cccgatgtcg agctgtcgca catgtatgcc gacaacggcg ccatgcagtt ggtgcgcaac       720
     ccgcgccaat tcgacgtgat cgtgaccgac aacctgttcg gcgacatcct gtcggatgcg       780
     gcggcgatgc tgaccggcag cctgggcatg ctgccctcgg ccagccttgg cgcgccgatg       840
     gcgaacggcc ggcccaaggc gctttacgag ccggtgcatg gctcggcccc cgacatcgcc       900
     gggcagggca aggccaaccc gatcgcctgc atcctcagct tcgccatgtg cctgcgctat       960
     tccttcggcc tgggtgccga ggccgatctg ctggaaaagg ccgtcgagag ggtgctggcc      1020
     gacggcgtgc gcaccggcga cctgatgggc gccgagggcg gcaagccggt ctcgaccgcc      1080
     gagatgggcg accacatcgt cgcggcgctt tcggcgctgt aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page