(data stored in ACNUC7421 zone)

EMBL: CP000489.PE438

CP000489.PE438       Location/Qualifiers
FT   CDS_pept        410232..411185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0441"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_0858 putative transporter,
FT                   RhaT family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68555"
FT                   /db_xref="GOA:A1AZ61"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ61"
FT                   /protein_id="ABL68555.1"
FT                   /translation="MTAGNVKGALLALLSMGLYSTHDVIIKLLGATYPALQILFFSALL
FT                   SFPPLAVLLLRDPTHGTLLPRNPFWVGLRSLCIVASGVGGFYAFSVLPLAQVYSILFAA
FT                   PLIVTVLSVPLLGEKVGLHRWLAVCAGLGGVLIVLRPGVTPLGLGHLAALMGATATALS
FT                   AIAVRRLGRSERTVILLLWPMIGNFLLTGASLGFAYRPMELGDLALTGVIAALGLAAGF
FT                   LLILAYQAGEAANVAPMQYSQMLWAVGYGWFLFGERPDGPTVLGAGLIMASGLYILMRE
FT                   RLGASRLRPATRARFGGEAVTAPRWSLLQRLLRERR"
     atgacggcgg gcaatgtcaa gggcgcgctg ctcgcccttc tgtccatggg gctctattcg        60
     acccatgacg tgatcatcaa gcttttgggc gcgacctatc cggcgttgca gatcctgttc       120
     ttctcggcgc ttctgtcctt tccgccgctg gcggtgctgc ttttgcgcga cccgacgcat       180
     ggcaccttgc tgccgcgcaa cccgttctgg gtcgggctgc gttcgctttg catcgtcgcc       240
     tcgggggtcg gcggctttta cgccttttcc gtgctgccct tggcgcaggt ctattccatc       300
     ctcttcgccg cgccgctgat cgtgaccgtg ctgtcggtgc cgctgctggg tgaaaaggtc       360
     gggctgcacc gctggctggc ggtctgcgcc gggcttggcg gcgtgctgat cgtgctgcgc       420
     cccggcgtga cgcccctggg gctggggcat ctggcggcgc tgatgggggc gacggcgacc       480
     gcgctttcgg ccatcgccgt gcggcgcctg ggccggtccg agcggacggt gatcctgctg       540
     ctgtggccga tgatcggaaa cttcctgctg accggcgcct cgctgggttt cgcctatcgc       600
     ccgatggagc tgggcgacct ggcgctgacc ggcgtgattg cggccctggg ccttgcggcg       660
     ggcttcctgc tgatcctggc ctatcaggcg ggcgaggcgg ccaatgtcgc gccgatgcag       720
     tattcgcaga tgctttgggc ggttggctat ggctggttcc tgttcggcga gcgcccggac       780
     gggccgacgg tgctgggcgc ggggctgatc atggcttcgg gcctctacat cctgatgcgc       840
     gagcggttgg gcgcctcgcg cctgcgcccg gcgacgcggg cgcgctttgg cggcgaggcg       900
     gtgaccgccc cgcgctggag cctgttgcag cgcctgctgc gcgagcggcg atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page