(data stored in ACNUC7421 zone)

EMBL: CP000489.PE439

CP000489.PE439       Location/Qualifiers
FT   CDS_pept        411827..412228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68556"
FT                   /db_xref="GOA:A1AZ62"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ62"
FT                   /protein_id="ABL68556.1"
FT                   /translation="MKAVGYVACLLGGAVLCYLLLSLGVVDAVDGLPGTMQEPAIAMPT
FT                   YLGFMSAMMTAVTAVLAAVAIGIGVVTFFTFGGIKAEARKIASERVNELVNEKLSDDAI
FT                   KARIDEIAFGQGPRGELDEDFDPDDTGNR"
     atgaaggcag taggttatgt ggcctgcctc ttaggtggtg cggttctctg ctatctgctc        60
     ttgtcgcttg gtgtcgttga cgcagtcgat gggctgcccg gcactatgca agaacccgca       120
     atcgcgatgc ccacatatct tggctttatg tctgcgatga tgacggcggt taccgctgtg       180
     ttggcagcgg tcgcaatcgg gatcggggtt gttaccttct tcacctttgg cgggatcaag       240
     gctgaagccc ggaagatcgc cagtgagcgg gtaaacgaac tggtcaacga gaagctgtcg       300
     gacgacgcga tcaaggcacg cattgacgaa atcgcattcg ggcaagggcc gcgtggtgaa       360
     ctggatgaag actttgatcc agacgacaca ggcaaccgct ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page