(data stored in ACNUC7421 zone)

EMBL: CP000489.PE441

CP000489.PE441       Location/Qualifiers
FT   CDS_pept        412764..413840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68558"
FT                   /db_xref="InterPro:IPR025683"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ64"
FT                   /protein_id="ABL68558.1"
FT                   /translation="MVLENKSYVPTLAIRASEMNGLEFLPGATKDRMTPCILLAPWANS
FT                   LTLDRAIDRVERAFPNRNYFLDIDRDYQFTNLESGPQQELARLMESDNAFANWVEFVGR
FT                   HENAWPCIQSRGQSEADLRRQIEAIQELGRPYCMRIVRDRFPSNIQEIVAAFAAGGAAD
FT                   FAIILEGGWTRDPLTLSVWFEGVIAESLQEIDAAVPVVLSCTSIPKMFSAFSGITPVPF
FT                   SNRQLIDQISRRSNRTRVIYGDWGSTRPREESGFASRPLDRIDYPTDGAWYIVRNKDEE
FT                   WDFKAAAEELIENSDIWDGNLNIWGEEMIYQTTINEEIGIDTPQKNVAARVNIHLHRQA
FT                   FYGAGDIGGMNLDEDWED"
     atggtcctag agaataagag ctacgttcca actttggcta tccgcgccag cgaaatgaac        60
     gggcttgagt tcttgccggg ggcgacaaag gataggatga cgccctgcat ccttctcgcc       120
     ccttgggcca attccctcac cttagaccgg gctattgacc gcgttgagcg ggcattcccc       180
     aatcgcaact acttcctaga catagaccgg gactatcagt ttacgaacct tgagagcgga       240
     ccgcagcagg aattggcgcg gttgatggag tcggataacg ccttcgctaa ctgggtcgag       300
     tttgtggggc ggcatgagaa tgcgtggccc tgtatccagt ctaggggaca gagtgaagct       360
     gacctaagaa ggcaaatcga agccattcag gagctggggc gtccgtactg catgaggatc       420
     gtgcgggatc ggttccccag caacatccaa gaaatcgttg cggccttcgc ggctgggggt       480
     gctgctgact tcgcgatcat cctagaggga ggctggactc gggacccatt gactctttcg       540
     gtgtggttcg agggcgtgat tgccgaaagc ctgcaagaga ttgatgcggc tgtgcctgtg       600
     gtgctttcat gtacttccat tccgaagatg ttctctgcat ttagcggcat cacgccggtt       660
     ccattcagca accgtcagct aatcgaccaa atctcgcgca ggtctaaccg tacgcgagtc       720
     atctatggtg actgggggag tacccgaccg cgtgaagaga gtggcttcgc aagccgcccg       780
     ctggaccgca tcgattaccc cacggacggc gcttggtata tcgtccggaa taaggatgaa       840
     gagtgggact ttaaagccgc cgccgaagag ctgattgaga atagcgacat ctgggatggg       900
     aatcttaaca tctggggcga agagatgatc tatcagacca caatcaacga agaaatcggc       960
     atcgataccc cgcagaagaa cgtggcggcg cgggttaaca tccaccttca ccggcaagcg      1020
     ttctatgggg ccggtgacat tggtggaatg aaccttgatg aggattggga agactag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page