(data stored in ACNUC7421 zone)

EMBL: CP000489.PE444

CP000489.PE444       Location/Qualifiers
FT   CDS_pept        416175..419363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpa:BPP0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68561"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ67"
FT                   /protein_id="ABL68561.1"
FT                   /translation="MTWFNLLLMPENLLWAWRKARRCYRMADGLFDQAEIAAFELNLEA
FT                   ELTAIRHDFETGNWRNRPIRLVPQPKKPDKEGKPRLRQYFEISVRDQVAWIALVNVLGP
FT                   ELDQRMPAWSYGNRLYRAAWYEEETAEGQNSKLNIGPYRHSAGYLYRHFKHSWPLFRRH
FT                   ISLTARKMVGKSIEEDDLDAGERLALEQGDELAYFHPTFWNRPASGDNTLYAASLDLSK
FT                   FYPSVQVSAIQRGFDTLVEGFSDEPRLSALLSAMLRFEVDDGGLDQALKAKVDPIAPVG
FT                   SFDGIPTGLFVGGFLANVAMLPIDREVEKLLLQHRNIAHFRFVDDHEFLAYDFDRLLEW
FT                   MTEYAHLLARHGIGVEIEREKYSPAELKWLLHPDETVEPKKLSELRSVAIAAASVDGRK
FT                   PTQLMTRTLAQVSMLAATDFDLLTDAGRSQRLEQLEWLLLANIPDNEIRGDTRMAFAAA
FT                   RIANLTPALFRPNEELLLEHRRLKALTRGKAPADLEPAMVKPFLDRIAELEKTEQENWA
FT                   ALVKRHFGLLFEAFATHPDKVRLFTRLLDYCRVTGHNGFDRMRRWMDDHTDDDHKFLQS
FT                   YLGAMALHVLARHVLTASVALSQPDLLHRERGAARAFLENLVRADLEAFVPRASEAVRL
FT                   QQFQWNARRAFEAALMLGATEIAMTDATLSNEMLVRAIGPEKAAAPGFVVLFEMTGVPL
FT                   GVWFHWLFTTTGAHPMQPPVYWATAAKSYEPSRPEDWNGLRRYPRLLPPAAWKRLAEDP
FT                   FLLKSDDEGWLLDAARTQPDRFAGLPNIAPVIADVRARVGNSRATLSLVEWTEKTAVMD
FT                   SSDPRRSEWTALEIVRQILEPIFEPEGPDIDYLDRLHPEDVGIPFEWLPADWRALPEAT
FT                   DAGDKITWEAWQSLTRRSRVAHSPGMRDYRYHEVLVSVDDRAWPRRLRALGQILWGILR
FT                   QSFVLPAAWNIRGQERSLIEIVAHDIERLTISSFTISILRACLLPRSRETSMLTQFPML
FT                   FGNAKGQSADDTEFDQLIDSPDALLAQIKQAQDVLQKSQMTVLEHKPRQLIPVRLRQMG
FT                   AFIDGMPSEEELGL"
     atgacctggt tcaatcttct cctcatgcca gaaaacttgc tctgggcatg gcgcaaggcg        60
     cgacgctgct atcgtatggc agacggactt tttgatcagg ctgagattgc ggccttcgag       120
     ctgaatctcg aagccgaact gaccgctatt cggcacgact tcgagacagg gaactggaga       180
     aacagaccaa tcaggttggt tccccaaccg aaaaagccgg acaaggaggg aaagccacgg       240
     ctaagacaat actttgagat ttccgttcgc gatcaagtcg cttggatcgc tctcgtcaat       300
     gttctggggc cggaattgga tcagaggatg ccggcgtgga gctacggaaa tcggctgtat       360
     cgtgctgcat ggtatgagga ggaaaccgct gaagggcaaa actccaagct aaatattggg       420
     ccctatcgac actcagcagg ttatctttac cgacatttca aacatagttg gccgctcttc       480
     cggcgccaca tctcactcac cgctcgcaag atggtcggga aaagcattga ggaggacgat       540
     cttgatgccg gcgaacgctt ggccctcgag cagggcgacg aacttgccta cttccaccca       600
     acgttctgga atcgtccagc gtcaggcgac aatacgctct atgctgcatc gctggacctg       660
     agtaaattct acccgtcggt gcaggtttcg gcgatccaac gaggcttcga tactctggta       720
     gaagggtttt ctgacgaacc ccgcctctca gcacttctct ctgcaatgct tcggtttgag       780
     gtcgacgacg gaggcctcga ccaagctctc aaggccaaag tcgatcctat tgcgcccgtc       840
     ggatcgttcg atggcatccc gacaggcttg ttcgtcggtg gcttcctcgc gaacgtcgcc       900
     atgctcccaa tcgatcgtga ggtcgagaag ctgctgctgc aacaccgcaa cattgctcat       960
     tttcgcttcg tcgacgacca tgagttcctc gcatacgatt tcgaccggct cctagagtgg      1020
     atgaccgaat acgcccatct gctcgcacga cacggcatcg gtgtagagat cgagcgcgag      1080
     aaatacagtc cggcggaatt aaaatggctg cttcaccccg acgagacagt cgagcctaag      1140
     aaactatcgg agcttcgatc cgtcgcgatc gctgccgcgt ctgttgatgg tcgcaagccc      1200
     acccagctta tgacgcggac cttagcgcag gtttcgatgt tggcagcgac cgattttgac      1260
     ttactgaccg atgctggccg tagtcagcgg cttgagcaac tcgaatggct attgctcgcc      1320
     aatatccctg acaacgaaat tcgcggcgat actcgcatgg ccttcgccgc tgcgcggata      1380
     gccaacctca cgcccgcctt gtttcgtcca aacgaggagc ttctgctcga acatcgccgg      1440
     ctcaaggcgc tcacccgtgg caaggcaccc gcagatctgg aacccgctat ggtcaagcca      1500
     tttcttgacc gcatcgctga actcgaaaaa actgagcagg aaaactgggc tgcactcgta      1560
     aagcgtcatt tcgggctgct ctttgaggct tttgccaccc atcctgacaa ggtcaggctt      1620
     ttcacgcgtt tgctggatta ctgccgggtg accggacaca atggttttga ccgcatgcgt      1680
     cgctggatgg acgaccacac cgacgatgat cacaagttcc tgcagtcgta tctgggagcg      1740
     atggcgttac acgtcctcgc tcgacatgtc ctaactgcca gcgttgccct ctctcagcct      1800
     gacctactcc accgcgaacg tggtgcggcg cgagcctttc ttgagaatct ggtgcgcgcg      1860
     gatctcgagg ctttcgtccc ccgcgcaagc gaagctgtcc gattgcaaca gttccagtgg      1920
     aatgcgcgtc gggcattcga ggccgcacta atgcttgggg cgactgagat agcgatgacg      1980
     gacgccacgc tctcgaatga gatgctggtc cgagcgatag ggcccgaaaa ggcggcagca      2040
     cctggcttcg tcgtgctgtt cgaaatgact ggagtgccgc tgggggtatg gttccactgg      2100
     ctgttcacga ccaccggcgc acatcccatg cagccgcccg tctactgggc gacggccgcc      2160
     aagagttatg aacctagccg ccccgaggac tggaacggtc tgagacgcta tccccggctc      2220
     ttgccccctg ccgcctggaa gcgcttggcc gaggatccgt tccttcttaa gagtgacgac      2280
     gagggctggc tgctcgacgc agcacgaacg cagcctgatc gctttgcggg gctaccgaac      2340
     atcgccccgg tcatagccga cgttcgtgcg cgggtaggta actctcgagc gacgctgtca      2400
     cttgtggaat ggaccgagaa gacagcggtg atggactcca gtgatccacg ccgatcagaa      2460
     tggactgcgc tagagatcgt tcggcagatc cttgagccga tcttcgagcc cgaagggccc      2520
     gacatagatt atctagatag gcttcatcct gaggacgtag gcattccatt cgaatggcta      2580
     cctgccgatt ggagggcgct gccagaggcg accgacgcgg gcgataagat cacatgggag      2640
     gcttggcaaa gcctgacacg ccgtagcagg gttgcccatt cccccggaat gagggactat      2700
     cgctatcatg aggtgctggt atcggtcgac gaccgcgctt ggccacgccg cctccgtgcg      2760
     ctcggtcaga ttctctgggg catattgcgt cagagcttcg tcctgccggc agcctggaac      2820
     atccgcggcc aggagcggag cctgatcgaa atcgtagccc acgatatcga gcggcttacg      2880
     atctcgtcct tcaccatctc tatccttcgg gcatgtctgc tcccacgaag tcgagagacc      2940
     tcgatgctga cacagtttcc catgttgttc ggtaatgcga aggggcagtc agccgatgac      3000
     accgagttcg atcagcttat cgacagccct gacgccctgc tggcgcaaat caagcaggca      3060
     caggacgtat tgcagaagag ccagatgacc gtcctagagc ataaaccccg acaacttatt      3120
     ccggttcgac tccgacagat gggcgcgttt atcgatggca tgccaagcga ggaagagctc      3180
     ggactatga                                                              3189
//

If you have problems or comments...

PBIL Back to PBIL home page