(data stored in ACNUC7421 zone)

EMBL: CP000489.PE445

CP000489.PE445       Location/Qualifiers
FT   CDS_pept        419360..420268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpa:BPP0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68562"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ68"
FT                   /protein_id="ABL68562.1"
FT                   /translation="MTTPPSPTLTPFLKVGIIQTSLDPAAAWAAVPKMSPCEEERAITE
FT                   IRGFFAAFHQEQPPPDIIVLPELSVPTGYEATLRRMAGKMQSIVIAGLDYRVGGKPGEV
FT                   HNEALLIVPKRWRNRKMGAKATTRRIGKTYAAPEEDKKLKSISCEFKRDPSVWLFDGDE
FT                   IGAFGVMVCYDFLDLERIAMYRGKVQHLFILALNKDATSFRHVAEAVARMVFCNVIICN
FT                   CGHFGGSLAVSPYRLSERRTIYQHAGPGLATAQIIELPVERLGLHQKGGDPLKDGIKEF
FT                   KSLPPGYQFSVALLEKLARLV"
     atgacaactc cacctagccc aacgctcacc ccctttctca aggttggcat cattcagacc        60
     tccctcgatc ccgctgctgc ttgggcggcc gtccctaaga tgtcgccgtg cgaggaggaa       120
     agagctatca cggagatccg gggattcttc gcggctttcc accaagagca accgccaccg       180
     gacatcatag tgctgccaga actctcggtg cccaccggct atgaggcgac cctacgtaga       240
     atggccggga agatgcagtc gattgtgatt gccgggctcg attatcgcgt cggaggtaag       300
     cctggcgagg ttcacaatga ggcactgctc attgttccta agaggtggcg caatcggaag       360
     atgggggcca aggcgacaac acggcgcatc ggcaaaacct atgcggcacc ggaggaagac       420
     aagaagctca aaagtatctc gtgtgaattt aagcgcgatc cgtcagtgtg gctgttcgat       480
     ggggacgaaa ttggcgcgtt cggcgtgatg gtctgctacg acttcctcga tctcgagcgg       540
     atcgcgatgt atcgtggaaa ggtgcagcac ctcttcatct tagcgctcaa taaagatgcg       600
     acgtcttttc gccacgtcgc tgaagcggtc gcacgcatgg tgttctgtaa tgtgatcatt       660
     tgcaattgcg ggcatttcgg tggttcactc gccgtatctc cttaccgtct atccgagcgc       720
     cgaacgatct atcagcatgc tggacctggg cttgccaccg cccagattat cgagttaccc       780
     gtcgaaaggc tgggactgca tcagaaggga ggtgacccgc tcaaggatgg catcaaggag       840
     ttcaaaagcc tgccgcccgg ctaccagttc tcggtggcgc tgctcgagaa gctggcgagg       900
     ctcgtctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page