(data stored in ACNUC7421 zone)

EMBL: CP000489.PE448

CP000489.PE448       Location/Qualifiers
FT   CDS_pept        complement(421964..422515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb2_0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68565"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ71"
FT                   /protein_id="ABL68565.1"
FT                   /translation="MSGPYDPRAIANLMLDEADRRGWKITNLALQKLLYFAHGIHLTKT
FT                   KRPLVSGYFEAWQYGPVHPAVYRAFKPSGSAPIINRAAAKDPLTGKTRDLPKPTDLEVI
FT                   DLVSDVMRSYGHLPPGRLVDLSHAKDSPWSVVVDKARTDVAFGMRIPDDVIIARFRHHK
FT                   VSVGTSPRAGEPPSDDAPFA"
     atgagtgggc catacgatcc gagggcaatc gcgaacctca tgctggacga ggcggatcgg        60
     cgcggctgga aaatcacgaa ccttgccctc cagaagctgc tctacttcgc tcacggcata       120
     cacctaacca agacgaagcg cccgctcgtg tcgggctact tcgaggcgtg gcagtacggc       180
     cccgtgcatc cagccgtcta tcgggcgttc aagccgtcag gctccgcacc catcatcaac       240
     cgggcggccg cgaaagaccc gctcacaggc aagacgcgtg atctgccaaa gccgacggac       300
     cttgaagtca tcgacctcgt gtccgacgtg atgagatcat acgggcacct cccgcctgga       360
     cggctggtcg atctgtccca cgcgaaggac tcgccgtggt cggtggtcgt ggacaaagca       420
     cgaacagatg ttgcttttgg gatgcggata ccggatgatg tgatcatcgc ccgattccgc       480
     caccataagg tgtcggtcgg cacaagtcct cgtgcaggag aaccgcctag tgacgacgcg       540
     ccttttgcct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page