(data stored in ACNUC7421 zone)

EMBL: CP000489.PE457

CP000489.PE457       Location/Qualifiers
FT   CDS_pept        431234..432751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0461"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   sme:SMc03282 putative transposase number 1 for insertion
FT                   sequence ISRM27"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68574"
FT                   /db_xref="GOA:A1AZ80"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ80"
FT                   /protein_id="ABL68574.1"
FT                   /translation="MPGRHVTDHQTRLFMKLRQDHPIETAAAKAGLSRSTGYRIVNDPR
FT                   LPSQKKGARGRRRPDPLEHIFEAEVVPMLQSAPGLRPVAIYEEMLRRHPELQPGIRRTL
FT                   ERRIRAWRALHGEDREVMFRQVHEPGRLGLSDFTDMGALGVTITGQLLDHLLYHFRLPW
FT                   SGFEHAHVILGGESFVALAEGLQNALWSAGGAPACHRTDSLSAAFRNLDADARTDLTTR
FT                   YEALCTQYRMVPTRNNKGVAHENGAIESAHGHLKAAVRDALLMRGSADFDHLDHYRAFI
FT                   DEIVGRRNAARGKGIAAERAHLQVLPTRRTTDFEEVIVTVTGTGGFTLRKVFYTVPSRL
FT                   IGHRLRVRLFDDRLEVFTGGTHLLTLPRGRAQANGKHDQVVNYHHVIHSLRKKPMALAG
FT                   LVYRDKLFPRPEYRRAWEALNEALPARQACRITVELLALAHDRGCEAELAAEIGRVLQD
FT                   GGLPDLSILRARFSPDPEQLPVITVTSPRLSSYEALIRAPELAEARA"
     gtgccgggtc gccatgtaac cgatcatcag acgaggcttt tcatgaagct gagacaagac        60
     catcccattg agaccgccgc cgcgaaggcg gggctgagcc ggtcgacggg ctatcggatc       120
     gtaaacgacc cgcgcctgcc gtcgcagaag aagggagccc gcggtcgccg ccgccccgac       180
     ccgctggagc atattttcga ggccgaggtg gtgccgatgt tgcagtcggc ccccgggttg       240
     cggccggttg ccatttacga ggagatgctg cgccgccatc ccgaacttca accgggcatt       300
     cgccgcacgc tggagcgccg gatccgggcc tggcgagctc tccacggcga ggatcgggag       360
     gtcatgttcc gacaggtcca cgaacctggg cggctcggcc tgtcggactt caccgacatg       420
     ggcgcactcg gcgtgacgat caccgggcag ctgctcgatc acctgcttta ccatttccgg       480
     ctgccgtggt cggggttcga acatgcccat gtcatcctgg gcggcgagag cttcgtggct       540
     ttggccgagg ggttgcagaa cgcgctgtgg tcggcgggcg gcgcccccgc ctgtcaccgc       600
     accgacagcc tttcggccgc gttccgcaac cttgacgccg atgcccggac ggacctgacc       660
     acgcgctacg aagcgctgtg cacccagtac cgcatggtgc cgacgcgcaa caacaagggc       720
     gtggcacatg agaacggggc gatcgaaagc gcccatggcc atctcaaggc cgctgtccgg       780
     gacgcactgc tgatgcgcgg cagcgccgac ttcgatcacc tagatcacta tcgcgccttc       840
     atcgacgaga ttgtcgggcg caggaatgcg gccagaggta aggggatcgc ggccgagcgt       900
     gcccatctgc aggtgcttcc gacacggcgc accaccgact tcgaggaggt gatcgtcacg       960
     gtgaccggca ccggcggctt caccctgcgc aaggtgttct acaccgtgcc ctcgcgcctg      1020
     atcgggcatc ggctgcgggt gcgcttgttc gatgaccggc tggaagtctt caccggcgga      1080
     acgcatcttc tgaccctgcc gcgcgggcgt gcgcaggcca atggcaagca cgatcaggtg      1140
     gtgaactatc atcacgtcat ccattccctg cgcaagaagc cgatggctct ggcgggcctg      1200
     gtctatcgcg acaagctctt ccctcgaccg gaatatcgcc gggcctggga ggcgctcaat      1260
     gaggcgttgc ccgcccggca ggcctgcagg atcactgtcg agcttctggc cctggcccat      1320
     gatcgcggct gcgaggccga actggccgcc gagatcggcc gcgtcctgca agacggtggt      1380
     ttgcccgacc tgtccatcct gcgcgcacgg ttctcgcccg atcccgaaca gctgccggtc      1440
     atcacggtga cctcgccccg gctcagcagc tacgaggcgc tgatccgtgc cccggagttg      1500
     gcggaggccc gcgcatga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page