(data stored in ACNUC7421 zone)

EMBL: CP000489.PE458

CP000489.PE458       Location/Qualifiers
FT   CDS_pept        432748..433326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0462"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   sme:SMc03281 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68575"
FT                   /db_xref="GOA:A1AZ81"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ81"
FT                   /protein_id="ABL68575.1"
FT                   /translation="MKPASHTVDGARLGIMLNELRLPTIKTLWPRFAEQADREGWPAAR
FT                   FLAAIAEHELAERAHRRIARHLAEAHLPPGKTLDSFAFEAVPMISKAQVSAMAAGDSWL
FT                   AKGANVLMFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELQLEAAI
FT                   AKLDKFDLLILDDLAYAHPVCRAAAASSR"
     atgaaacctg catcccacac cgtcgacggc gcgcgcctcg gcatcatgct caacgagttg        60
     aggctgccga cgatcaagac cctctggccc cgcttcgccg aacaggcgga tcgggagggc       120
     tggcctgccg cccgcttcct tgccgcgatc gccgagcatg aactggccga gcgtgcgcat       180
     cgcaggatcg cgcgacatct ggccgaggcc catctgccgc ccggaaagac cctcgacagc       240
     ttcgccttcg aagccgtgcc catgatctcg aaggcccagg tctccgccat ggccgcaggc       300
     gacagctggc tggccaaggg cgccaatgtg ctcatgttcg gtccgcccgg cggcggcaag       360
     agccacctcg cggctgcgat cggcctggcg ctcatcgaga acggctggcg cgtcctcttc       420
     acaaggacca ccgacctcgt ccagaagctg caggttgccc gcagggaact gcagctcgag       480
     gccgccatcg cgaagctcga caagttcgac ctgctgatcc tcgacgacct cgcctatgct       540
     catcctgttt gtcgcgcggc agccgcgagc tctcggtaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page