(data stored in ACNUC7421 zone)

EMBL: CP000489.PE46

CP000489.PE46        Location/Qualifiers
FT   CDS_pept        complement(36818..37519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0046"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rsp:RSP_2281 two-component
FT                   trancriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68163"
FT                   /db_xref="GOA:A1AY19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY19"
FT                   /protein_id="ABL68163.1"
FT                   /translation="MTDTPLIAILDDEPEIRRLLSSALEEAGFRTVSFARATEFEAALR
FT                   RIQPDACLIDLGLPDRDGLALVHRLASESGAAIIIISGRAQVQDRVTGLELGADDYIIK
FT                   PFDPAEVVARIRARLRKPQRETGPGRQQIRFAGWSADFDRYTLTSPEGAETPISHAEAE
FT                   VLRLFLDNPRRLISRAQMLETLGGTAGESFDRAMDVRISRLRTKLGEDPKNPRLIKTIY
FT                   GAGYIFLAELG"
     atgactgaca cccccctgat cgccattctc gacgacgagc ccgaaatccg ccgcctgcta        60
     tcctcggcgc tggaggaggc cggttttcgc accgtcagct tcgcccgcgc caccgaattc       120
     gaggcggcgc tgcgccgcat ccagcccgat gcctgcctga tcgacctggg cctgcccgac       180
     cgcgacgggc tggcgctggt ccaccggctg gccagcgaat ccggcgcggc gatcatcatc       240
     atctcgggcc gggcgcaagt gcaggaccgc gtgaccgggc tggagttggg cgccgacgac       300
     tacatcatca agcccttcga tccggccgag gtggtggccc gcatccgcgc gcggctgcgc       360
     aagccgcagc gcgagaccgg ccccggccgc cagcagatcc gctttgccgg ctggtccgcg       420
     gatttcgacc gctatacgct gacctcgccc gaaggggccg agaccccgat cagccatgcc       480
     gaggccgagg tgctgcggct gtttctcgac aatccacgcc ggctgatctc gcgcgcgcag       540
     atgctggaaa cgctgggagg cacggcgggc gaaagctttg accgggcgat ggacgtgcgc       600
     atctcgcgcc tgcgcaccaa gctgggcgaa gaccccaaga acccacgcct gatcaagacc       660
     atctacggcg cgggctatat cttcctggcc gaactgggct ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page