(data stored in ACNUC7421 zone)

EMBL: CP000489.PE460

CP000489.PE460       Location/Qualifiers
FT   CDS_pept        434326..435324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0464"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: nha:Nham_3955
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68577"
FT                   /db_xref="GOA:A1AZ83"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ83"
FT                   /protein_id="ABL68577.1"
FT                   /translation="MLAIDLAKGSFQVCAVAADGAVLYNRVMSRTRLAALLAEQPACVV
FT                   AMEACATSHHWGRMAQSHGHEVRLVPAVYVKPFVKRQKNDRADAEAIAEAALRPTMRFV
FT                   AVKSADTQGRAVAFRTHQCLVRQRTQLINALRGHLAEFGLVAPKGPASLKVLENALADP
FT                   ASDVPGPVREMGAIYVEQIARLTEVIGRLAEELEAASRTDTQLRRLCTIPRIGPVTAGA
FT                   VAAFAPDLDTFDSGRNFAAWLGLVPRQRSTGGKTRLGSVSKMGQTDIRRLLIVGAMSVI
FT                   RWVVRKGGSANRWLAALVMRKPKMVAAVALANKMARMIWALTTKEQDYRMA"
     atgctggcga ttgacctggc gaagggcagc tttcaggtct gtgcggtcgc agcggatggg        60
     gcggttctat acaaccgcgt gatgtcacgg accagattgg cagcgctatt ggcggagcaa       120
     ccagcctgcg tagtggccat ggaggcctgc gccacgtcgc atcactgggg ccgcatggcg       180
     caatcccacg gtcacgaagt gcgtctggtc cctgctgtgt atgtgaagcc gttcgtaaag       240
     cgccaaaaga atgaccgggc ggatgctgag gccatcgcgg aggcagccct ccgcccgacc       300
     atgcggttcg tggcggtcaa gagtgccgac acacagggtc gcgcagtggc gtttcggacc       360
     catcaatgcc tggtccggca acgcacgcaa ctcatcaacg ccctccgcgg gcatctggcc       420
     gagttcggac tggtggcgcc gaaggggcct gcgagcctga aggtcctaga gaacgcgctg       480
     gcagatccag ccagcgatgt gccaggccct gtccgggaga tgggcgcgat ctacgtcgag       540
     cagatcgcga ggctgacaga ggtgatcgga cgactggcgg aggaactcga ggccgcatcg       600
     aggacagata cgcagctccg tcggttgtgc accatcccca ggatcggacc agttactgcc       660
     ggcgccgtcg cggcattcgc accggatctc gacacgttcg acagcgggcg caattttgcc       720
     gcctggctcg gcctggtgcc gcgccagaga tcaacgggcg gcaaaaccag attgggctct       780
     gtcagcaaga tggggcagac cgatatccgc cgcctgctga tcgtcggcgc catgagtgtg       840
     atccgctggg tcgtccgcaa ggggggcagc gcgaaccgtt ggctggccgc gctcgtgatg       900
     cgcaagccga agatggtcgc ggcagtcgcg ctggcgaaca agatggcccg gatgatttgg       960
     gcgctgacga caaaagaaca ggattacaga atggcgtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page