(data stored in ACNUC7421 zone)

EMBL: CP000489.PE465

CP000489.PE465       Location/Qualifiers
FT   CDS_pept        440577..441365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0470"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: pau:PA14_72890 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68582"
FT                   /db_xref="GOA:A1AZ88"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ88"
FT                   /protein_id="ABL68582.1"
FT                   /translation="MQQNLSPTPRKRRPGGGRKQVAAPSLPVLASGDEETLAQKVYDAL
FT                   QAGLMAGSIEPGMPLTVRSLSQVMGVSATPVREALKLLEADGVLEARNKSAFYARELGS
FT                   EEMRQVLDMRLALEGLAVRRAALAVGPDDLDRISRLNDHYATALRAAGDNGPLILERNH
FT                   QFHFAIYALCGSPILLQTIETMWLRIGPTLHLYIDAGGMDGDFPRYHEDMIDALRERDA
FT                   DAAEAALRDDLIAAARKILRLQASETTGNRQPYILENVDL"
     atgcagcaga atctttcacc cacaccacgc aagcgccgtc cgggcggcgg gcgcaagcag        60
     gtggcggcgc cgagcctgcc ggttctggca agcggtgatg aggagacgct ggcgcaaaag       120
     gtctatgatg ccttgcaggc aggattgatg gcgggcagca tcgagccggg aatgcctttg       180
     accgtgcgat cattgtcgca ggtcatgggg gtcagcgcga ccccggttcg cgaggcgctc       240
     aaactgctgg aagccgatgg cgtgctggag gcccgcaaca agagcgcatt ctatgcccgt       300
     gaattgggca gcgaagagat gcggcaggtg ctggacatgc gtcttgcgct ggaggggttg       360
     gcggtccgcc gggctgcctt ggcggtcggg ccggacgatc tggacaggat ctcgcggctg       420
     aacgatcatt atgcaaccgc gctgcgcgcc gcgggggaca acggcccatt gatcctggaa       480
     cgcaatcacc agtttcattt tgccatctac gcgctttgcg gctcgccgat cctgctgcag       540
     accatcgaga cgatgtggct gcggatcggc ccaaccctgc atctctacat tgacgcgggc       600
     ggcatggacg gggatttccc gcgctatcac gaggacatga tcgatgcgct gcgcgagcgg       660
     gatgccgatg ccgccgaagc tgccctgcgc gatgacctga ttgctgccgc ccgcaagatc       720
     ctgcgcctgc aggcgtctga gacaacaggc aatcggcagc cctatatcct cgaaaacgtc       780
     gatctctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page