(data stored in ACNUC7421 zone)

EMBL: CP000489.PE466

CP000489.PE466       Location/Qualifiers
FT   CDS_pept        441610..442539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0471"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bur:Bcep18194_C7701 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68583"
FT                   /db_xref="GOA:A1AZ89"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ89"
FT                   /protein_id="ABL68583.1"
FT                   /translation="MPKKVIITCAVTGGLHTPTMSPYLPITPDEIAEAAIGAAKAGAAI
FT                   IHLHARDPESGRPKQDPDLFLQFLPRIKQATGAVLNITTGGGLGMTLEERLRPAHRAKP
FT                   EVCSLNMGTMNFCAFELAGKYDSWKHDWEKPYLESTRDLIYANTYAMLETIMVEVGQAH
FT                   GTRFEFECFDLSHLEAVRYFAAKGLIKPPFLIQGIFGVMGGMGATIENLIHFHGVAQRL
FT                   FGSDMEFSAFAVGRRQMHFLTVAAILGGSVRVGLEDSVYIGRGELATSNAQQVQKIRRI
FT                   VEELGLEVASPDEARARLSLKGGDRVDF"
     atgccgaaga aggtcattat cacctgcgcc gtcaccgggg ggctgcacac gccgaccatg        60
     tcgccctatc tgccgatcac tccggacgag atcgcggaag ccgccatcgg cgcggccaag       120
     gcaggggcgg cgatcatcca tctgcatgcg cgcgatcccg aaagcggccg cccgaaacag       180
     gaccccgacc tgttcctgca attcctgccg cggatcaagc aggccaccgg cgcggtgctg       240
     aacatcacca ccggcggcgg ccttggcatg acgctggaag agcggctgcg tcccgcacat       300
     cgcgccaagc ccgaggtttg cagcctcaac atgggcacga tgaacttctg cgccttcgaa       360
     ctggcgggaa aatacgacag ctggaagcac gattgggaaa agccctatct ggaaagcacg       420
     cgcgacctga tctacgccaa tacctatgcc atgctggaaa ccatcatggt cgaggtcggc       480
     caggcgcatg gcacgcggtt tgaattcgag tgcttcgatc tcagtcatct ggaggcggtg       540
     cgctatttcg ccgccaaggg gctgatcaag ccccccttcc tgatccaggg catcttcggc       600
     gtgatgggcg gcatgggcgc gacgatcgag aacttgattc atttccatgg tgtcgcgcaa       660
     cgcctgttcg gcagcgacat ggagttttcc gcctttgccg tcgggcgcag gcagatgcat       720
     ttcctgaccg tcgcggcgat cttggggggc tcggtccggg tcgggttgga ggacagcgtt       780
     tacatcggcc ggggcgaact ggctacgtcg aacgcgcagc aggtgcagaa gatccgccgg       840
     atcgtcgagg agctgggact ggaggtcgct tcgcccgacg aggcacgcgc gcggctgtcg       900
     ctgaagggcg gcgaccgcgt cgatttctaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page