(data stored in ACNUC7421 zone)

EMBL: CP000489.PE467

CP000489.PE467       Location/Qualifiers
FT   CDS_pept        442556..444619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0472"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   reu:Reut_C6223 5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68584"
FT                   /db_xref="GOA:A1AZ90"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ90"
FT                   /protein_id="ABL68584.1"
FT                   /translation="MRLASDTGGTFTDLVVEEDDGRITMYKSPTVPDDPVLGVLRALEL
FT                   AAEDRGLSLQELMARADTFIHGTTHAINAIITGNVARTALLVTKGHRDILVFREGGRVE
FT                   PFNQSIPFPRPYIPRDLTYEIPERILSTGAIHRDLDEAAVIGVLQSLKEQQVEAVAVCL
FT                   LWATINPAHELRVGELIAEHLPGVPYTLAHDVNPTLREFRRASSAAIDASLKPLMGHYL
FT                   SGLTDRIRGEGFTGDIMLLTSSGGMVDAAEVARSPIKVINSGPSMAPISGHYYARAEAQ
FT                   ADDVIVADTGGTTYDISLVRKGVVPITRELWIGRPLLGHLVGYPSVEVKSVGAGGGSIA
FT                   HVDQGGLLRVGPQSAGAKPGPVCYRQGGTKPTVTDASVALGHIDPDFFLGGRIKLDRPA
FT                   AIEAIRKQVAEPLGMSVDEASWQIIALATEGMVQAIADITVAQGIDPANAVLIGGGGAA
FT                   GLNSTFIARRLGCKSLVIPETGAALSAAGAMMSPLISEYATSIFVSSDRFDREALAAAI
FT                   ERLRAKCEDFASRSPAASGAPRISFVAEARYEGQVWDIDVKFDPQKILGPDGSEIFRAG
FT                   FDDMHEQIFAVRDPGSAVEIIGIRATLRADIRRDVEFRLHSPGALSGDHRPREIYFHGY
FT                   GRLQTPVLRLEAIAPGRPGQGPAIIESAFTTIVVDPDARFHRSGTGSIVIHP"
     atgcgattgg caagcgatac cggcggcacc tttaccgatc tggtcgtcga ggaggacgac        60
     ggccggatca ccatgtacaa gtcgcctacc gtgcccgacg atccggtgtt gggcgtgctg       120
     cgcgcgctgg aactggccgc cgaagatcgg ggcctgtcgc tgcaggaact gatggcgcgc       180
     gccgatacat tcatccacgg caccacccat gcgatcaacg cgatcatcac cggcaatgtc       240
     gcccgcaccg cgctgctggt caccaaaggc catcgcgaca tcctggtgtt ccgcgagggc       300
     gggcgggtcg agcccttcaa ccagtccatc ccgtttccgc gtccctatat cccgcgcgat       360
     ctgacctatg agatccccga gcggatcctg tcgaccggcg cgatccatcg cgatctggac       420
     gaagcggcgg tgatcggggt gctgcagtcg ctgaaggaac agcaggtcga ggcggtggca       480
     gtctgcctgc tctgggcaac gatcaatccg gcgcatgagc tgcgcgtagg cgaattgatc       540
     gccgaacacc tgccgggcgt cccctatacg ctggcccatg acgtcaaccc gacgctgcgc       600
     gagtttcgcc gggcgtcctc ggcggctatc gacgcctcgc tgaaaccgct gatggggcat       660
     tacctcagcg ggctgaccga ccggatccgg ggcgagggtt tcaccggcga catcatgttg       720
     ctgaccagca gcggtggcat ggtcgatgcg gccgaggttg cgcgctcgcc gatcaaggtg       780
     atcaacagcg ggccgtcgat ggcgccgatc tcggggcatt attatgcgcg ggccgaggcg       840
     caggcggatg acgtgatcgt cgctgatacc ggcgggacca cctatgacat cagtctggtg       900
     aggaagggcg tggtgccgat cacgcgggaa ttgtggatcg gtcggccgct gctgggtcat       960
     ctggtcggct acccttcggt cgaggtgaaa agcgtcggcg cgggcggtgg ttccatcgct      1020
     catgtcgatc agggcggcct gctgcgcgtc gggccgcaaa gcgcgggcgc gaagcccggg      1080
     ccggtctgct accggcaggg cggtacgaag cccactgtaa ccgatgcctc ggtcgcgctt      1140
     ggccatatcg acccggactt cttccttggc gggcgtatta agctggaccg tcccgccgcc      1200
     atcgaggcga tccggaagca ggtggccgag ccgctgggca tgtcggtcga tgaggcgagt      1260
     tggcagatca tcgcgttggc gaccgagggc atggtgcagg ccatcgccga tattaccgtc      1320
     gctcagggga tcgacccggc caatgcggtg ctgatcggcg gcggcggtgc ggcgggcctg      1380
     aactcgacct tcattgcgcg ccgcttgggc tgcaagtcgc tggtgatccc ggaaaccggc      1440
     gcggcgctgt ccgcagcggg tgcgatgatg tcaccgctga tcagcgaata tgcgaccagc      1500
     atcttcgtct cgtcggaccg tttcgatcgc gaggcacttg ccgccgcaat cgaaaggctc      1560
     cgtgcgaaat gcgaagactt cgccagccga agccctgcag ccagcggcgc gccccggatc      1620
     agcttcgtcg ccgaggcgcg atacgagggg caggtctggg atatcgatgt gaagttcgac      1680
     cctcagaaga tccttgggcc tgacggcagc gaaatcttcc gcgccggctt cgacgatatg      1740
     cacgaacaga tcttcgcggt gcgcgatccc ggctctgcgg tcgagatcat cggcatccgc      1800
     gccaccttgc gcgccgatat ccgccgggat gtcgagttcc gcctgcattc gccgggcgcc      1860
     ctttccggtg atcaccggcc gcgcgagatc tatttccacg gctatgggcg gctgcagacg      1920
     ccggtcctgc ggctcgaggc gattgcgccg ggacggcccg gccaaggccc ggcgatcatc      1980
     gaatccgcct tcaccaccat cgtcgttgat cccgatgcgc gctttcaccg ctcgggaacc      2040
     ggcagcatcg tcattcatcc gtga                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page