(data stored in ACNUC7421 zone)

EMBL: CP000489.PE471

CP000489.PE471       Location/Qualifiers
FT   CDS_pept        447538..447990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0476"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bja:blr1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68588"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ94"
FT                   /protein_id="ABL68588.1"
FT                   /translation="MDDSKPRQIETGRRVVYPWYCDVMGHLATQHYMAFLDDAFLHFMA
FT                   ELAPLPQPERLGWADVRHEIDYLAELRAGNLVVLRSSLLAIGRKSIRHQTEIRRQGCGT
FT                   VCARVISTTVRFDLDARRAIDVEPGIAARAQALDLLPRAASKPSCP"
     atggatgaca gtaagccgcg ccagatcgag accggcaggc gggtggtgta tccgtggtat        60
     tgcgatgtca tggggcatct ggcgacgcag cactacatgg cgttccttga cgatgccttc       120
     ctgcatttca tggcggaact ggcgcccctg ccccaacccg aacggctggg ctgggccgat       180
     gtccgccacg agatcgacta tctggccgaa ctccgggcgg gcaatctcgt ggtgctgcgc       240
     agcagtcttc tggcaatcgg gcgcaagtcg atccgccacc agaccgagat ccggcggcaa       300
     ggctgtggca cggtctgcgc ccgcgtgatc tcgaccaccg tccgcttcga cctcgacgcc       360
     cgccgcgcca tcgatgtcga acccgggatc gccgctcgcg cacaggcgct ggacctgctg       420
     ccccgggccg cgtccaagcc atcttgcccc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page