(data stored in ACNUC7421 zone)

EMBL: CP000489.PE472

CP000489.PE472       Location/Qualifiers
FT   CDS_pept        448044..448658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0477"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: bur:Bcep18194_B1227
FT                   transcriptional regulator, XRE family with cupin sensor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68589"
FT                   /db_xref="GOA:A1AZ95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ95"
FT                   /protein_id="ABL68589.1"
FT                   /translation="MARKIEGTRIQSGLPERLRALRERKGWSLNRAAEEVGVPPSTLSR
FT                   IENRKMSPTLDLLLKIVRTFDMHPNDVFSGRPDQQEKQEISVSRASDPALIELPNLFYK
FT                   HLHPDMECFNFRAILITLFARSVEEYGGLTAHSGQEFVYLLSGKLQVHLEGHPLVTLAP
FT                   GDSIMFTSSIPHAYVSAGDSQAKLLIASSSEEDVLQVKFQK"
     atggccagga aaatcgaagg gacccggatt caatccggcc tgccagagcg gctacgggcg        60
     ttgcgggaac gcaagggctg gtcgctcaat cgggctgcgg aagaggtggg cgtgccgccc       120
     agcaccctgt cgcggatcga gaaccgcaag atgtcgccga cgctggatct gctgctgaag       180
     atcgtccgca ccttcgacat gcatcccaac gacgtcttct ctggccgccc cgaccagcag       240
     gaaaagcagg aaatcagcgt ctcgcgcgcc agcgatccgg cgctgatcga gctgccgaac       300
     ctgttctaca agcatctgca ccccgatatg gagtgcttca atttccgcgc tatcctgatc       360
     accctgttcg cccgctcggt cgaggaatat ggcgggctga ctgcgcattc cgggcaggaa       420
     ttcgtctatc tgctgagcgg caagctgcag gtccatcttg agggacatcc gctggtcacc       480
     ctggcccccg gcgacagcat catgttcacc agcagcattc cgcacgccta tgtctcggca       540
     ggtgattcgc aggcgaagct gttgatcgca tcctcgtcgg aagaagacgt ccttcaggtc       600
     aagtttcaga aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page