(data stored in ACNUC7421 zone)

EMBL: CP000489.PE476

CP000489.PE476       Location/Qualifiers
FT   CDS_pept        complement(452349..452849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1799 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68593"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ99"
FT                   /protein_id="ABL68593.1"
FT                   /translation="MQPKPMRARLDSADALDRALSHCPASRVSERYVRVLGQNRSTQRR
FT                   LSRDRDDERQLTDDIVALARRYGSYTFNRISDSGAFSLSCTSAEPASVIGLSLSAPAPK
FT                   VRSALSFAVSLWCVSSQLAEVNAFGERIASRDPDRQAAKVQIRVAPMNRLNALGIAEIE
FT                   RVA"
     atgcaaccaa aaccgatgcg ggcaaggttg gactcggctg acgcgctaga ccgagccctt        60
     tcgcactgcc ctgctagccg cgtgtcggag cggtatgtcc gcgtgctggg gcagaaccgt       120
     tccacgcagc gtcgcctttc tcgcgaccgg gatgacgagc ggcaattgac cgacgacatc       180
     gttgcactgg cccgccgcta tggcagctac accttcaata ggatttcgga cagcggcgcc       240
     ttctccttgt cctgcacctc agccgagccg gcttcggtca tcggcctcag cttatcggct       300
     ccggcgccca aggtcaggtc ggccctgtcc ttcgcggtca gcttgtggtg cgtcagttcc       360
     caacttgctg aggtcaacgc cttcggcgag cgcatcgcat cacgggaccc ggaccgccaa       420
     gcagccaaag tccagatccg cgttgcgccc atgaaccgcc tcaatgcact cggcatcgca       480
     gagatcgaac gcgtggcctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page