(data stored in ACNUC7421 zone)

EMBL: CP000489.PE477

CP000489.PE477       Location/Qualifiers
FT   CDS_pept        453006..453269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0482"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: sme:SMc03949
FT                   nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68594"
FT                   /db_xref="GOA:A1AZA0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA0"
FT                   /protein_id="ABL68594.1"
FT                   /translation="MPHPQPSSGPREAKLFRNNKSQAVRIPADFEMPGDRVNIYRDGNR
FT                   LIIEPLRRKNLLEVLAGLDPLGPEDQFPDVDETLLPAKEIDL"
     atgccgcatc cgcagccatc ttcagggcct cgtgaagcca agctcttccg caacaacaag        60
     agccaggccg tccgcatccc ggctgacttc gagatgccgg gggatcgggt gaacatctat       120
     cgtgacggga accggcttat catcgagccg ctgcgccgca agaacctgct tgaagtgctg       180
     gccggactag acccgcttgg gccagaggat cagtttcctg atgtggacga gacgcttctc       240
     ccggccaagg aaatcgacct ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page