(data stored in ACNUC7421 zone)

EMBL: CP000489.PE481

CP000489.PE481       Location/Qualifiers
FT   CDS_pept        455218..455601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68598"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA4"
FT                   /protein_id="ABL68598.1"
FT                   /translation="MSTLNIHLDTGANLRTGFTEAGELAVIVNTREAIPALYFRSYEDL
FT                   HRVLTPSRLRVVMALAGQGVMSIDELARRVGRDAPAVHQDVITLADAGVIDHTEKGAEF
FT                   PHRGIHLDFWVDLSDGNMQRHEQ"
     atgagcactc tgaacatcca tctggacacg ggggccaatc ttcggacagg cttcaccgaa        60
     gcaggcgaac tggccgttat agtcaacacc cgcgaggcga tccccgcgct gtattttcgc       120
     agctacgagg atctgcatcg ggttctcaca ccttctcgtc tcagggttgt catggcgctt       180
     gccgggcaag gggtcatgtc cattgacgag cttgcgcgcc gggtcgggcg cgatgcgcca       240
     gccgtgcatc aggacgtaat cacgctcgca gatgcggggg ttatcgacca tactgaaaaa       300
     ggcgccgaat ttccccatcg cggcatccac cttgatttct gggtagattt atcggacggg       360
     aacatgcaac ggcatgagca ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page