(data stored in ACNUC7421 zone)

EMBL: CP000489.PE482

CP000489.PE482       Location/Qualifiers
FT   CDS_pept        complement(455768..456088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68599"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA5"
FT                   /protein_id="ABL68599.1"
FT                   /translation="MPQTARALSSGCARNPRVICARQHGMKHRPPCLRSTITKMGIDHG
FT                   HAATLRHHESKLREIHVSPGRAGSIVAKKGGTIVAIWKCYEISESLALFSIRILNESSG
FT                   FG"
     atgccccaga cggctcgggc tctttcatcc ggctgcgccc gcaacccgcg ggtcatctgc        60
     gcgagacagc acgggatgaa gcatcgcccg ccatgcctcc gctcgaccat tacgaagatg       120
     ggtatcgacc acggccatgc cgccacgctg cggcatcatg aatccaagct gcgggaaatc       180
     catgtaagcc ccggccgcgc aggaagcata gtagcaaaaa agggggggac tatcgtggca       240
     atctggaagt gctatgaaat ttcagagagt cttgctctgt tctccatccg aatcttgaac       300
     gaatccagtg gctttggcta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page