(data stored in ACNUC7421 zone)

EMBL: CP000489.PE484

CP000489.PE484       Location/Qualifiers
FT   CDS_pept        complement(460736..461500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68601"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA7"
FT                   /protein_id="ABL68601.1"
FT                   /translation="MASRPSINPMGRGMALAAGTAAMLTLPVLPAQAANFTPPAGCKLE
FT                   VTVQNRGCSVSQHYRCSADTAGDQWVTYFTPEGPTFQSRIDRETRWMESTDLRTGLTDV
FT                   LEDQAQDHASFSTLLDSGQDDFDFWTRSNSGERLHHVGHDELTGETVQVDGVTLEVTRF
FT                   ELTTYSESGQVLIQRRGQQFISRAQGRFYGGVETSEDWTGAVQQTNDSPVTFSFPGHPG
FT                   FGSTTPEYDCDLQMVGGQGAGALWQLVKEART"
     atggcatctc gaccaagcat caaccccatg gggcgcggca tggcgctggc ggcaggaacg        60
     gcagctatgc tgacccttcc cgtgctgcct gcccaggcgg cgaatttcac cccgcccgcc       120
     ggctgcaagc tggaggtgac ggtgcagaac cgcggttgca gcgtctcgca gcattaccgt       180
     tgcagcgccg atacggcggg cgaccaatgg gtgacctatt tcacccccga gggtccgacc       240
     ttccagtcgc gcatcgaccg cgagacgcgc tggatggaaa gcaccgacct gcgcaccggc       300
     ctgaccgacg tgctggagga tcaggcgcag gaccacgcct cgttcagcac gctgctggat       360
     agcgggcagg acgatttcga tttctggacc cgctcgaaca gcggcgagcg gctgcatcat       420
     gtcggccatg acgaactgac cggcgagacg gtgcaggtcg acggcgtgac gctggaggtc       480
     acgcgcttcg agctgaccac ctatagcgaa tccggccagg tgctgatcca gcgccggggc       540
     cagcaattca tcagccgcgc gcaagggcgg ttctatggcg gcgtcgagac ctccgaggac       600
     tggaccggcg ccgtgcagca gacgaacgac agcccggtga cgttctcgtt cccggggcat       660
     cccggctttg gctcgaccac gccggaatat gattgcgacc tgcagatggt gggcggccaa       720
     ggcgccggcg ccctgtggca gcttgtgaag gaggcacgga cgtga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page