(data stored in ACNUC7421 zone)

EMBL: CP000489.PE491

CP000489.PE491       Location/Qualifiers
FT   CDS_pept        469024..469374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0496"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein; KEGG: sit:TM1040_2886 Hpt
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68608"
FT                   /db_xref="GOA:A1AZB4"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB4"
FT                   /protein_id="ABL68608.1"
FT                   /translation="MLDWSRINELRGEVGDDEFQLILELFLDEVEGVIMRLSRRDALRL
FT                   ETDLHFLKGCASNLGFADFGDLCDACERKAAGGRPAEVDIESLLASYAASKRALMGRLD
FT                   AALHPGRGGRRA"
     atgctggatt ggagccgcat caacgaactg cgcggggagg tcggcgatga cgagttccag        60
     ctgatcctgg aactgtttct ggacgaggtc gaaggcgtca tcatgcgtct gtcgcgccgc       120
     gatgcgctgc ggctggaaac cgacctgcat ttcctgaagg gttgcgcctc gaacctgggc       180
     tttgccgatt tcggcgatct ctgcgatgcc tgcgaacgca aggcagccgg tggcaggccg       240
     gccgaggtcg atatcgaatc cctgctggcc agctatgccg cctcgaagcg ggcgctgatg       300
     ggccggctgg atgcggcgct gcatcccggc cggggcgggc gccgtgcctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page