(data stored in ACNUC7421 zone)

EMBL: CP000489.PE492

CP000489.PE492       Location/Qualifiers
FT   CDS_pept        complement(469382..470620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0497"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM: Threonine
FT                   dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: sil:SPO0020 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68609"
FT                   /db_xref="GOA:A1AZB5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB5"
FT                   /protein_id="ABL68609.1"
FT                   /translation="MENFAASVRQAGVALRDLFEPTPLQKNDHLSAKYGAEIWLKREDL
FT                   TPVRSYKLRGAFNAMRKIGAGSQGHFVCASAGNHAQGMAYACRHFGTRGTIFMPVTTPK
FT                   QKIDKTRIFGNGVIEIVLTGDYFDQTLAAAQDFARAQGATFLSPFDDADIIEGQATVGL
FT                   ELLDQIGAAPDLVVLPVGGGGLAAGVTRLLAELAPGTRAEFAEPEGGGSLREALLAGAP
FT                   VTLPVVDNFVDGAAVARIGDLPFRTLAGFDADRVHTAPEDRICATMLEMLNIEGIVLEP
FT                   AGALAVDVLRDIPDLAGKRVVCICSGGNFDFERLPEVKERAQRFSGLKRYFILRMPQRP
FT                   GALRDFLQLLGPQDDIARFEYLKKSARNFGSVLIGIETTAPENLDRLRERLETAGIGYR
FT                   DITHDPALAEFLI"
     atggaaaact ttgccgcctc tgtccgccag gcaggggtcg cgctgcgcga cctcttcgag        60
     ccgacgcccc tgcagaagaa cgaccacctc tcggcgaaat acggagccga gatctggctg       120
     aaacgcgaag acctgacacc ggtgcgcagc tacaagctgc gcggcgcctt caacgccatg       180
     cgcaagatcg gtgccggctc gcagggccat ttcgtctgcg ccagcgccgg caaccatgcc       240
     cagggcatgg cctatgcctg ccgccatttc ggcacccgag gcaccatctt catgcccgtc       300
     accacgccga agcaaaagat cgacaagacc cgtatcttcg gcaacggcgt catcgagatc       360
     gtgctgaccg gcgattattt cgaccagacc ctggccgcgg cgcaggattt cgcccgggcc       420
     cagggcgcga ccttcctgtc gcccttcgac gatgcggaca tcatcgaggg gcaggccacg       480
     gtcgggctgg aactgctcga ccagattggc gccgcgccgg atctcgtcgt cctgccggtc       540
     ggcggcggcg ggctcgcggc cggggtcaca cgcctgcttg ccgaactggc gcccggcacc       600
     cgcgccgagt tcgccgagcc ggaaggcggt ggcagcctgc gcgaagcgct gctggccggt       660
     gcccccgtga cgctgcccgt agtggacaat ttcgtcgacg gcgccgccgt ggcgcggatc       720
     ggcgacctgc cctttcgcac actggccggc tttgacgccg accgggtcca taccgcgccc       780
     gaggatcgca tctgcgccac catgctggag atgctgaaca tcgaaggcat cgtgctggag       840
     cccgccgggg cgctggcggt ggacgtattg cgcgacattc ccgacctggc cggcaagcgc       900
     gtggtctgca tctgctcggg cgggaatttc gacttcgagc gcctgcccga agtcaaggag       960
     cgcgcccagc gcttctcggg gctgaagcgc tatttcatcc tgcgcatgcc gcagcggccg      1020
     ggcgccctgc gcgactttct gcaactgctc ggcccccagg acgacatcgc gcgtttcgaa      1080
     tacctgaaga agtcggcgcg caacttcggc tcggtcctga tcggcatcga gaccaccgct      1140
     cccgagaatc tggaccggct gcgcgaaagg ctggaaacgg ccggaatcgg ctatcgcgac      1200
     atcacccacg acccggcgct ggcggaattc ctgatctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page