(data stored in ACNUC7421 zone)

EMBL: CP000489.PE496

CP000489.PE496       Location/Qualifiers
FT   CDS_pept        473477..474028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0501"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: bmb:BruAb2_0726 MogA,
FT                   molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68613"
FT                   /db_xref="GOA:A1AZB9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB9"
FT                   /protein_id="ABL68613.1"
FT                   /translation="MTQNPAADRPAHVAIVTVSDRAASGEYEDKGGPGAEDWLHATITS
FT                   PMDITRRIIPDGREIVADCLRDLADEQGADLILITGGTGPAPRDQTPEAMADVIEKELP
FT                   GFGEEMRRASLREVPTAILSRQTAGIRGATLMITIPGKPSAIATCLDAVFAAVPYCLDL
FT                   IGAAYIETDPARIKAFRPKK"
     atgacccaga accccgccgc cgatcgcccc gcccatgtcg ccatcgtcac cgtctcggac        60
     cgtgccgcca gcggcgaata cgaggacaag ggtggcccgg gggccgagga ctggctgcac       120
     gccaccatca cctcgcccat ggacatcacg cgccgcatca tccccgacgg gcgcgagatc       180
     gtcgcggatt gcctgcgcga ccttgccgac gaacagggcg ccgacctgat cctgatcacc       240
     ggcggcaccg gcccggcgcc acgcgaccag acgcccgagg cgatggccga tgtcatcgaa       300
     aaggagttgc ccggctttgg cgaggagatg cgccgcgcca gcctgcgcga ggtgccgacc       360
     gccatcctgt cgcgccagac ggcgggcatc cgtggcgcga cgctgatgat caccattccc       420
     ggcaagccct ctgccatcgc cacctgcctc gatgcggtct ttgcggcggt gccctattgc       480
     ctcgacctga tcggcgcggc ctatatcgaa accgacccgg cccgcatcaa ggcgtttcgg       540
     ccgaagaaat ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page